gvim-9.0.1040-150000.5.31.1<>, c3`p9|o(鳲s X#.Io jl,`q8/|~~ ~?)zyߴXJN>DUd@|-ql׻9w". ;nK]X[[Xt#o^וY%}!pkmsv SރzNSz1o Za]_)VM8R\8[wdikES2>om gP{C9` @΢xLcZ1.>HX?Hd  +8<DHa L T      4  / d//HLQ(U8\9:>e@mBuFGHIXYZ[\]0^ bac defluv w4xy5zDCgvim9.0.1040150000.5.31.1A GUI for ViPackage gvim contains the largest set of features of vim, which is graphical windows and language interpreter, like python, ruby, or perl. You need package vim for the help and other documentation too. If you want less features, you might want to install vim instead.c3`sheep21D5=SUSE Linux Enterprise 15SUSE LLC Vimhttps://www.suse.com/Productivity/Text/Editorshttp://www.vim.org/linuxx86_64/usr/sbin/update-alternatives \ --install /usr/bin/vim vim /usr/bin/gvim 30 \ --slave /usr/bin/vi vi /usr/bin/gvimif [ ! -e /usr/bin/gvim ] ; then /usr/sbin/update-alternatives --remove vim /usr/bin/gvim fiBr C&F,A큤c3_c3_c1c1c1c1c1c1c1c1c2c1c1c1c1c1c1c3_c1c,c1c1c1c1c1c1c1c1eb11b7c69c69545648aa3ca1112202f957784cbd6fcf4c4c0655736bda157f82761bba80e57d7bb566bd56c4369c6777d92b54f9b77ef8a1edc3ecc4c397feeb9214a5266181ac8e4bb41475f3e1c4c9d66359d7faedf8c2a15f0cbe591a820196946503aad0bab7ef3fa89e74f9fd44294c1ad24aa6ff7c1ee428fc43b8bad970f2d6483d137ebc955e26b69792aabe094867ae21582f99c008a146068fe50508795d7de0debd3ce4d8d7012d3a468d0008a470abeb5b87a46f01ffb7e3ea0bd203547ea1a77a3202cceda1b017a54628250e2f0443e8d947146387145eaa097f1c006a109948927f594b3915999ed80293e0b592a7706efafedb212411be3ca7620817e07ddab0ae17a5cb7bddeda01a42119c9863aacb48f37f1784b17f22b498011da6e6641951421a79de2e1c6ed4977d08a82afc14538e957c806d7544a8fc3d48d94761e5e255c76c7ddee31b7ef5c0cde8c919cf92a3a0c08ec58390946dce274e5051e4853cb1bf3483966bb349cd2a9e575af7e773c1ffdcaff749gvimgvimgvimgvimgvimgvimgvimgvimgvimgvim/etc/alternatives/vi/etc/alternatives/vim@@Irootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootvim-9.0.1040-150000.5.31.1.src.rpmapplication()application(gvim.desktop)config(gvim)gvimgvim(x86-64)gvim-basegvim-enhancedgvim_clientmimehandler(application/x-shellscript)mimehandler(text/english)mimehandler(text/plain)mimehandler(text/x-c)mimehandler(text/x-c++)mimehandler(text/x-c++hdr)mimehandler(text/x-c++src)mimehandler(text/x-chdr)mimehandler(text/x-csrc)mimehandler(text/x-java)mimehandler(text/x-makefile)mimehandler(text/x-moc)mimehandler(text/x-pascal)mimehandler(text/x-tcl)mimehandler(text/x-tex)vivim_client@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@    /bin/sh/bin/shconfig(gvim)gvim_clientlibICE.so.6()(64bit)libSM.so.6()(64bit)libX11.so.6()(64bit)libXt.so.6()(64bit)libacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libcairo.so.2()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libgdk-3.so.0()(64bit)libgdk_pixbuf-2.0.so.0()(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libgpm.so.2()(64bit)libgtk-3.so.0()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libpango-1.0.so.0()(64bit)libpangocairo-1.0.so.0()(64bit)libperl.so()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.3.3)(64bit)libtinfo.so.6()(64bit)libtinfo.so.6(NCURSES6_TINFO_5.0.19991023)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)update-alternativesupdate-alternativesvim-data9.0.1040-150000.5.31.13.0.4-14.6.0-14.0-15.2-19.0.1040-150000.5.31.1gvim8.24.14.1cR@c~ @cM@bb@`4@`.V^)@^@^2\@Zľ@ZlZ@Z%Z1@Z@V͛@V͛@VIV@V@VVŲ@V@V@VT@VV@V@V^VVuFVm]Vd#@VQ@VO @VCV VUU6@U@U@UnU@UUUx&U_@U>$U+UUQTT!TD@TfTr@T T TT|TTxcTk4T[bTBV@zbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comlnussel@suse.delnussel@suse.delnussel@suse.deidonmez@suse.comlnussel@suse.deidonmez@suse.comstefan.bruens@rwth-aachen.dekukuk@suse.delnussel@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comnormand@linux.vnet.ibm.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.commpluskal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comwerner@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comkukuk@suse.desuse-beta@cboltz.dekukuk@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comdimstar@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comcrrodriguez@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comlars@linux-schulserver.deidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.de- Updated to version 9.0 with patch level 1040, fixes the following security problems * Fixing bsc#1206028 VUL-0: CVE-2022-3491: vim: Heap-based Buffer Overflow prior to 9.0.0742 * Fixing bsc#1206071 VUL-0: CVE-2022-3520: vim: Heap-based Buffer Overflow * Fixing bsc#1206072 VUL-0: CVE-2022-3591: vim: Use After Free * Fixing bsc#1206075 VUL-0: CVE-2022-4292: vim: Use After Free in GitHub repository vim/vim prior to 9.0.0882. * Fixing bsc#1206077 VUL-0: CVE-2022-4293: vim: Floating Point Comparison with Incorrect Operator in GitHub repository vim/vim prior to 9.0.0804. * Fixing bsc#1205797 VUL-0: CVE-2022-4141: vim: heap-buffer-overflow in alloc.c 246:11 * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.814...v9.0.1040- Updated to version 9.0 with patch level 0814, fixes the following problems * Fixing bsc#1192478 VUL-1: CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow * Fixing bsc#1203508 VUL-0: CVE-2022-3234: vim: Heap-based Buffer Overflow prior to 9.0.0483. * Fixing bsc#1203509 VUL-1: CVE-2022-3235: vim: Use After Free in GitHub prior to 9.0.0490. * Fixing bsc#1203820 VUL-0: CVE-2022-3324: vim: Stack-based Buffer Overflow in prior to 9.0.0598. * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c * Fixing bsc#1203152 VUL-1: CVE-2022-2982: vim: use after free in qf_fill_buffer() * Fixing bsc#1203796 VUL-1: CVE-2022-3296: vim: stack out of bounds read in ex_finally() in ex_eval.c * Fixing bsc#1203797 VUL-1: CVE-2022-3297: vim: use-after-free in process_next_cpt_value() at insexpand.c * Fixing bsc#1203110 VUL-1: CVE-2022-3099: vim: Use After Free in ex_docmd.c * Fixing bsc#1203194 VUL-1: CVE-2022-3134: vim: use after free in do_tag() * Fixing bsc#1203272 VUL-1: CVE-2022-3153: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0404. * Fixing bsc#1203799 VUL-1: CVE-2022-3278: vim: NULL pointer dereference in eval_next_non_blank() in eval.c * Fixing bsc#1203924 VUL-1: CVE-2022-3352: vim: vim: use after free * Fixing bsc#1203155 VUL-1: CVE-2022-2980: vim: null pointer dereference in do_mouse() * Fixing bsc#1202962 VUL-1: CVE-2022-3037: vim: Use After Free in vim prior to 9.0.0321 - ignore-flaky-test-failure.patch: Ignore failure of flaky tests - disable-unreliable-tests-arch.patch: Removed - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.0313...v9.0.0814- Updated to version 9.0 with patch level 0313, fixes the following problems * Fixing bsc#1200884 Vim: Error on startup * Fixing bsc#1200902 VUL-0: CVE-2022-2183: vim: Out-of-bounds Read through get_lisp_indent() Mon 13:32 * Fixing bsc#1200903 VUL-0: CVE-2022-2182: vim: Heap-based Buffer Overflow through parse_cmd_address() Tue 08:37 * Fixing bsc#1200904 VUL-0: CVE-2022-2175: vim: Buffer Over-read through cmdline_insert_reg() Tue 08:37 * Fixing bsc#1201249 VUL-0: CVE-2022-2304: vim: stack buffer overflow in spell_dump_compl() * Fixing bsc#1201356 VUL-1: CVE-2022-2343: vim: Heap-based Buffer Overflow in GitHub repository vim prior to 9.0.0044 * Fixing bsc#1201359 VUL-1: CVE-2022-2344: vim: Another Heap-based Buffer Overflow vim prior to 9.0.0045 * Fixing bsc#1201363 VUL-1: CVE-2022-2345: vim: Use After Free in GitHub repository vim prior to 9.0.0046. * Fixing bsc#1201620 PUBLIC SUSE Linux Enterprise Server 15 SP4 Basesystem zbalogh@suse.com NEW --- SLE-15-SP4-Full-x86_64-GM-Media1 and vim-plugin-tlib-1.27-bp154.2.18.noarch issue * Fixing bsc#1202414 VUL-1: CVE-2022-2819: vim: Heap-based Buffer Overflow in compile_lock_unlock() * Fixing bsc#1202552 VUL-1: CVE-2022-2874: vim: NULL Pointer Dereference in generate_loadvar() * Fixing bsc#1200270 VUL-1: CVE-2022-1968: vim: use after free in utf_ptr2char * Fixing bsc#1200697 VUL-1: CVE-2022-2124: vim: out of bounds read in current_quote() * Fixing bsc#1200698 VUL-1: CVE-2022-2125: vim: out of bounds read in get_lisp_indent() * Fixing bsc#1200700 VUL-1: CVE-2022-2126: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1200701 VUL-1: CVE-2022-2129: vim: out of bounds write in vim_regsub_both() * Fixing bsc#1200732 VUL-1: CVE-2022-1720: vim: out of bounds read in grab_file_name() * Fixing bsc#1201132 VUL-1: CVE-2022-2264: vim: out of bounds read in inc() * Fixing bsc#1201133 VUL-1: CVE-2022-2284: vim: out of bounds read in utfc_ptr2len() * Fixing bsc#1201134 VUL-1: CVE-2022-2285: vim: negative size passed to memmove() due to integer overflow * Fixing bsc#1201135 VUL-1: CVE-2022-2286: vim: out of bounds read in ins_bytes() * Fixing bsc#1201136 VUL-1: CVE-2022-2287: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1201150 VUL-1: CVE-2022-2231: vim: null pointer dereference skipwhite() * Fixing bsc#1201151 VUL-1: CVE-2022-2210: vim: out of bounds read in ml_append_int() * Fixing bsc#1201152 VUL-1: CVE-2022-2208: vim: null pointer dereference in diff_check() * Fixing bsc#1201153 VUL-1: CVE-2022-2207: vim: out of bounds read in ins_bs() * Fixing bsc#1201154 VUL-1: CVE-2022-2257: vim: out of bounds read in msg_outtrans_special() * Fixing bsc#1201155 VUL-1: CVE-2022-2206: vim: out of bounds read in msg_outtrans_attr() * Fixing bsc#1201863 VUL-1: CVE-2022-2522: vim: out of bounds read via nested autocommand * Fixing bsc#1202046 VUL-1: CVE-2022-2571: vim: Heap-based Buffer Overflow related to ins_comp_get_next_word_or_line() * Fixing bsc#1202049 VUL-1: CVE-2022-2580: vim: Heap-based Buffer Overflow related to eval_string() * Fixing bsc#1202050 VUL-1: CVE-2022-2581: vim: Out-of-bounds Read related to cstrchr() * Fixing bsc#1202051 VUL-1: CVE-2022-2598: vim: Undefined Behavior for Input to API related to diff_mark_adjust_tp() and ex_diffgetput() * Fixing bsc#1202420 VUL-1: CVE-2022-2817: vim: Use After Free in f_assert_fails() * Fixing bsc#1202421 VUL-1: CVE-2022-2816: vim: Out-of-bounds Read in check_vim9_unlet() * Fixing bsc#1202511 VUL-1: CVE-2022-2862: vim: use-after-free in compile_nested_function() * Fixing bsc#1202512 VUL-1: CVE-2022-2849: vim: Invalid memory access related to mb_ptr2len() * Fixing bsc#1202515 VUL-1: CVE-2022-2845: vim: Buffer Over-read related to display_dollar() * Fixing bsc#1202599 VUL-1: CVE-2022-2889: vim: use-after-free in find_var_also_in_script() in evalvars.c * Fixing bsc#1202687 VUL-1: CVE-2022-2923: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0240 * Fixing bsc#1202689 VUL-1: CVE-2022-2946: vim: use after free in function vim_vsnprintf_typval * Fixing bsc#1202862 VUL-1: CVE-2022-3016: vim: Use After Free in vim prior to 9.0.0285 Mon 12:00- Deleted patches: * restrict-shell-commands.patch * source-check-sandbox.patch * vim-8.0.1568-CVE-2021-3778.patch * vim-8.0.1568-CVE-2021-3796.patch * vim-8.0.1568-CVE-2021-3872.patch * vim-8.0.1568-CVE-2021-3927.patch * vim-8.0.1568-CVE-2021-3928.patch * vim-8.0.1568-CVE-2021-3984.patch * vim-8.0.1568-CVE-2021-4019.patch * vim-8.0.1568-CVE-2021-4193.patch * vim-8.0.1568-CVE-2021-46059.patch * vim-8.0.1568-CVE-2022-0319.patch * vim-8.0.1568-CVE-2022-0351.patch * vim-8.0.1568-CVE-2022-0361.patch * vim-8.0.1568-CVE-2022-0413.patch * vim-8.0.1568-globalvimrc.patch - Added patches: * vim-8.1.0297-dump3.patch * vim-8.2.2411-globalvimrc.patch * disable-unreliable-tests-arch.patch - Updated patches: * disable-unreliable-tests.patch * vim-7.3-filetype_changes.patch * vim-7.3-filetype_ftl.patch * vim-7.3-filetype_spec.patch * vim-7.3-gvimrc_fontset.patch * vim-7.3-help_tags.patch * vim-7.3-mktemp_tutor.patch * vim-7.3-name_vimrc.patch * vim-7.3-sh_is_bash.patch * vim-7.3-use_awk.patch * vim-7.4-disable_lang_no.patch * vim-7.4-filetype_apparmor.patch * vim-7.4-filetype_mine.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch * vim-8.0.1568-defaults.patch * vim73-no-static-libpython.patch - Updated to version 8.2 with patch level 5038, fixes the following problems * Fixing bsc#1191770 VUL-0: CVE-2021-3875: vim: heap-based buffer overflow * Fixing bsc#1192167 VUL-0: CVE-2021-3903: vim: heap-based buffer overflow * Fixing bsc#1192902 VUL-0: CVE-2021-3968: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192903 VUL-0: CVE-2021-3973: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192904 VUL-0: CVE-2021-3974: vim: vim is vulnerable to Use After Free * Fixing bsc#1193466 VUL-1: CVE-2021-4069: vim: use-after-free in ex_open() in src/ex_docmd.c * Fixing bsc#1193905 VUL-0: CVE-2021-4136: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1194093 VUL-1: CVE-2021-4166: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1194216 VUL-1: CVE-2021-4193: vim: vulnerable to Out-of-bounds Read * Fixing bsc#1194217 VUL-0: CVE-2021-4192: vim: vulnerable to Use After Free * Fixing bsc#1194872 VUL-0: CVE-2022-0261: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1194885 VUL-0: CVE-2022-0213: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1195004 VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1195203 VUL-0: CVE-2022-0359: vim: heap-based buffer overflow in init_ccline() in ex_getln.c * Fixing bsc#1195354 VUL-0: CVE-2022-0407: vim: Heap-based Buffer Overflow in Conda vim prior to 8.2. * Fixing bsc#1198596 VUL-0: CVE-2022-1381: vim: global heap buffer overflow in skip_range * Fixing bsc#1199331 VUL-0: CVE-2022-1616: vim: Use after free in append_command * Fixing bsc#1199333 VUL-0: CVE-2022-1619: vim: Heap-based Buffer Overflow in function cmdline_erase_chars * Fixing bsc#1199334 VUL-0: CVE-2022-1620: vim: NULL Pointer Dereference in function vim_regexec_string * Fixing bsc#1199747 VUL-0: CVE-2022-1796: vim: Use After in find_pattern_in_path * Fixing bsc#1200010 VUL-0: CVE-2022-1897: vim: Out-of-bounds Write in vim * Fixing bsc#1200011 VUL-0: CVE-2022-1898: vim: Use After Free in vim prior to 8.2 * Fixing bsc#1200012 VUL-0: CVE-2022-1927: vim: Buffer Over-read in vim prior to 8.2 * Fixing bsc#1070955 VUL-1: CVE-2017-17087: vim: Sets the group ownership of a .swp file to the editor's primary group, which allows local users to obtain sensitive information * Fixing bsc#1194388 VUL-1: CVE-2022-0128: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1195332 VUL-1: CVE-2022-0392: vim: Heap-based Buffer Overflow in vim prior to 8.2 * Fixing bsc#1196361 VUL-1: CVE-2022-0696: vim: NULL Pointer Dereference in vim prior to 8.2 * Fixing bsc#1198748 VUL-1: CVE-2022-1420: vim: Out-of-range Pointer Offset * Fixing bsc#1199651 VUL-1: CVE-2022-1735: vim: heap buffer overflow * Fixing bsc#1199655 VUL-1: CVE-2022-1733: vim: Heap-based Buffer Overflow in cindent.c * Fixing bsc#1199693 VUL-1: CVE-2022-1771: vim: stack exhaustion in vim prior to 8.2. * Fixing bsc#1199745 VUL-1: CVE-2022-1785: vim: Out-of-bounds Write * Fixing bsc#1199936 VUL-1: CVE-2022-1851: vim: out of bounds read- Minimal fix for Bug 1195004 - (CVE-2022-0318) VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0413.patch - Fixing bsc#1190570 CVE-2021-3796: vim: use-after-free in nv_replace() in normal.c / vim-8.0.1568-CVE-2021-3796.patch - Fixing bsc#1191893 CVE-2021-3872: vim: heap-based buffer overflow in win_redr_status() drawscreen.c / vim-8.0.1568-CVE-2021-3872.patch - Fixing bsc#1192481 CVE-2021-3927: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-3927.patch - Fixing bsc#1192478 CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow / vim-8.0.1568-CVE-2021-3928.patch - Fixing bsc#1193294 CVE-2021-4019: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-4019.patch - Fixing bsc#1193298 CVE-2021-3984: vim: illegal memory access when C-indenting could lead to Heap Buffer Overflow / vim-8.0.1568-CVE-2021-3984.patch - Fixing bsc#1190533 CVE-2021-3778: vim: Heap-based Buffer Overflow in regexp_nfa.c / vim-8.0.1568-CVE-2021-3778.patch - Fixing bsc#1194216 CVE-2021-4193: vim: vulnerable to Out-of-bounds Read / vim-8.0.1568-CVE-2021-4193.patch - Fixing bsc#1194556 CVE-2021-46059: vim: A Pointer Dereference vulnerability exists in Vim 8.2.3883 via the vim_regexec_multi function at regexp.c, which causes a denial of service. / vim-8.0.1568-CVE-2021-46059.patch - Fixing bsc#1195066 CVE-2022-0319: vim: Out-of-bounds Read in vim/vim prior to 8.2. / vim-8.0.1568-CVE-2022-0319.patch - Fixing bsc#1195126 CVE-2022-0351: vim: uncontrolled recursion in eval7() / vim-8.0.1568-CVE-2022-0351.patch - Fixing bsc#1195202 CVE-2022-0361: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0361.patch - Fixing bsc#1195356 CVE-2022-0413: vim: use after free in src/ex_cmds.c / vim-8.0.1568-CVE-2022-0413.patch- install suse vimrc in /usr (boo#1182324, vim-8.0.1568-globalvimrc.patch)- source correct suse.vimrc file (boo#1182324)- stop owning /etc/vimrc so the old, distro provided config actually gets removed. Leaving it around leads to a duplicated autocmd for * .spec, leading to spec file template inserted twice. - own some dirs in vim-data-common so installation of vim-small doesn't leave not owned directories (boo#1173256). - Add vi as slave to update-alternatives so that every package has a matching "vi" symlink (bsc#1174564, boo#1176549).- Add restrict-shell-commands.patch to disable using interfaces in restricted mode, fixes bsc#1172225 CVE-2019-20807- introduce vim-small package with reduced requirements for small installations (boo#1166602). - BuildRequire pkg-config(krb5) instead of krb5-mini to be able to build against Tumbleweed repo.- Add source-check-sandbox.patch to fix CVE-2019-12735 boo#1137443- Pre-convert gvim icons, otherwise building vim depends on rsvg-convert -> librsvg -> cargo -> Rust -> LLVM - Cleanup SVG icon, make lines pixel-grid aligned - Correct RPM Group- Use %license instead of %doc [bsc#1082318]- instead of explicitly unsetting mouse, remove it from the defaults in the first place (boo#1079185, vim-8.0.1568-defaults.patch)- Switch to make -j1 clean to see if it fixes random build failures on Leap/SLE 15.- Updated to revision 1568, fixes the following problems * No test using a screen dump yet. * Screen dump test fails on MS-Windows. * Dead code found. * Assert_equalfile() does not close file descriptors. (Coverity) * Dump test fails when using a shadow directory. * Cannot use 24 bit colors in MS-Windows console. * Compiler warnings without termguicolors feature. * Libterm doesn't support requesting fg and bg color. * C syntax test fails when using gvim * C syntax test still fails when using gvim. * Quotestar test is flaky when using the GUI. * Xxd does not skip NUL lines when using ebcdic. * Popupmenu is too far left when completion is long. (Linwei) * No test for the popup menu positioning. * Popup menu positioning fails with longer string. * synpat_T is taking too much memory. * Terminal screen dump does not include cursor position. * With 'termguicolors' Normal color doesn't work correctly. * When using 'termguicolors' SpellBad doesn't show. * Screen dumps not included in distribution. * Using feedkeys() in a terminal window may trigger mappings. (Charles Sheridan) * Undo in the options window makes it empty. * Screen dump test script not included in distribution. * Various small problems in test files. * Various small problems in source files. * On Mac 'maxmemtot' is set to a weird value. * May leak file descriptors when executing job. * Cannot see what digraph is used to insert a character. * Custom plugins loaded with --clean. * Build error for some combination of features. * May not parse the t_RS response correctly, resulting in wrong characters in the input stream. * printf() does not work with only one argument. (Daniel Hahler) * No right-click menu in a terminal. * Build failure without GUI. * Build failure without GUI on MS-Windows. * Crash with rust syntax highligting. (Edd Barrett) * The terminal debugger can't set a breakpoint with the mouse. * Timeout of getwinposx() can be too short. (lilydjwg) * Too many #ifdefs. * Can't build Mac version without GUI. * Too many #ifdefs. * Cannot build Win32 GUI without IME. (John Marriott) * Can't build on older Mac, header file is missing.- Recommend vim-data so that colors can work by default- Updated to revision 1525, fixes the following problems * Compiler complains about uninitialized variable. (Tony Mechelynck) * Missing -D_FILE_OFFSET_BITS=64 may cause problems if a library is compiled with it. * Cannot act on edits in the command line. * Acessing freed memory after window command in auto command. (gy741) * Still too many old style tests. * Segmentation fault when Ruby throws an exception inside :rubyfile command. * Slow redrawing with DirectX. * Endless loop when gui_mch_stop_blink() is called while blink_state is BLINK_OFF. (zdohnal) * It is difficult to set the python home directory properly for Python 2.7 and 3.5 since both use $PYTHONHOME. * Terminal test fails on some systems. (jonathonf) * Terminal test fails on some slow terminals. * When in silent mode too much output is buffered. * If $SHELL contains a space then the default value of 'shell' is incorrect. (Matthew Horan) * Timer test on travis Mac is still flaky. * Clojure now supports a shebang line. * Filetype detection test does not check all scripts. * Cannot handle change of directory. * Missing file in patch. * Missing another file in patch. * Missing yet another file in patch. * Test fails without 'autochdir' option. * Completing directory after :find does not add slash. * Python2 and python3 detection not tested. (Matej Cepl) * Older GTK versions don't have gtk_entry_get_text_length(). * Libvterm doesn't handle illegal byte sequence correctly. * Illegal memory access in del_bytes(). * When package path is a symlink adding it to 'runtimepath' happens at the end. * Integer overflow when using regexp pattern. (geeknik) * On MS-Windows CursorIM highlighting no longer works. * MS-Windows: nsis installer is a bit slow. * MS-Windows: D&D fails between 32 and 64 bit apps. * Visual C 2017 has multiple MSVCVER numbers. * Invalid memory access in read_redo(). (gy741) * Screen isn't always updated right away. * Redraw flicker when moving the mouse outside of terminal window. * Unnecessary condition for "len" being zero. * Insert mode completion state is confusing. * Patch missing change. * Clearing a pointer takes two lines. * Using feedkeys() does not work to test Insert mode completion. (Lifepillar) * Searchpair() might return an invalid value on timeout. * Reduntant conditions. * Weird autocmd may cause arglist to be changed recursively. * Accessing invalid memory with "it". (Dominique Pelle) * Test 14 fails. * Emacs tags no longer work. (zdohnal) * There is no easy way to get the global directory, esp. if some windows have a local directory. * Number of spell regions is spread out through the code. * The minimum width of the popup menu is hard coded. * Memory leak in balloon_split(). * Completion items cannot be annotated. * No autocmd triggered in Insert mode with visible popup menu. * Having 'pumwidth' default to zero has no merit. * Clearing a pointer takes two lines. * Getting the jump list requires parsing the output of :jumps. * Getjumplist() returns duplicate entries. (lacygoill) * Out-of-memory situation not correctly handled. (Coverity) * Possible NULL pointer dereference. (Coverity) * Out-of-memory situation not correctly handled. (Coverity) * In out-of-memory situation character is not restored. (Coverity) * Access memory beyond end of string. (Coverity) * Win32: the screen may be cleared on startup. * Debugger can't break on a condition. (Charles Campbell) * New version of HP NonStop (Tandem) doesn't like the default header for setenv(). * Timer test is a bit flaky. * The :drop command is not always available. * Test for failing drag-n-drop command no longer fails. * Cannot test if a command causes a beep. * Some code for the debugger watch expression is clumsy. * Warning for possibly using NULL pointer. (Coverity) * The jumplist is not always properly cleaned up. * Getting the list of changes is not easy. * BufWinEnter event fired when opening hidden terminal. * Errors for job options are not very specific. * Invalid memory acces with pattern using look-behind match. (Dominique Pelle) * Error messages suppressed after ":silent! try". (Ben Reilly) * Getchangelist() does not use argument as bufname(). * Cursor is in the wrong line when using a WinBar in a Terminal window. * Shift-Tab does not work in a terminal window. * Popup menu is positioned in the wrong place. (Davit Samvelyan, Boris Staletic) * Cannot write and read terminal screendumps. * Compiler warnings for uninitialized variables. (Tony Mechelynck) * Using :wqa exits even if a job runs in a terminal window. (Jason Felice)- Split vim-data into vim-data-common package for low-disk usage scenarios bsc#1078722 bsc#1078554 bsc#1075541 - Make set mouse= default in suse.vimrc bsc#1079185 bsc#1078564 bsc#1067890 bsc#1064068 bsc#1062691- Updated to revision 1442, fixes the following problems * Crash when calling term_start() with empty argument. * Crash when term_start() fails. * MS-Windows: vimtutor fails if %TMP% has special chars. * After ":copen" can't get the window-ID of the quickfix window. (FalacerSelene) * Illegal memory access after undo. (Dominique Pelle) * GTK: :promtfind does not put focus on text input. (Adam Novak) * Memory leak in test_arabic. * Not enough information about what Python version may work. * Pkg-config doesn't work with cross compiling. * Filetype detection test not updated for change. * If cscope fails a search Vim may hang. * Terminal window: some vterm responses are delayed. * Using ":undo 0" leaves undo in wrong state. * Using pointer before it is set.- Make vim require vim-data bsc#1077352 bsc#1075541 bsc#1074790- Sort with spec-cleaner - Add conditional to build with python2 in order to build with py3 only enviroment - Convert dependencies to pkgconfig style- Updated to revision 1428, fixes the following problems * No test for expanding backticks. * Cursor column is not updated after ]s. (Gary Johnson) * Accessing freed memory in vimgrep. * Accessing invalid memory with overlong byte sequence. * No fallback to underline when undercurl is not set. (Ben Jackson) * Error in return not caught by try/catch. * The timer_pause test is flaky on Travis. * execute() does not work in completion of user command. (thinca) * "gf" and don't accept ? and & in URL. (Dmitrii Tcyganok) * The :leftabove modifier doesn't work for :copen. * Compiler warning on 64 bit MS-Windows system.- ignore make check transient errors for PowerPC bypass boo#1072651- Update apparmor.vim (taken from AppArmor 2.12) * add support for the "smc" network keyword- Updated to revision 1417, fixes the following problems * Encoding empty string to JSON sometimes gives "null". * Build fails with --with-features=huge --disable-channel. * Too much highlighting with 'hlsearch' and 'incsearch' set. * Cannot intercept a yank command. * It is not easy to see if a colorscheme is well written. * Memory leak when CTRL-G in search command line fails. * Pattern with \& following nothing gives an error. * :packadd does not load packages from the "start" directory. * Warnings and errors when building tiny version. (Tony Mechelynck) * Color scheme check script shows up as color scheme. * Cannot build with GTK but without XIM. (Guido) * Crash with nasty autocommand. (gy741, Dominique Pelle) * Using freed buffer in grep command. (gy741, Dominique Pelle) * Invalid memory access on exit when autocommands wipe out a buffer. * Duplicated code for getting a typed character. CursorHold is called too often in the GUI. (lilydjwg) * Difficult to track changes to a quickfix list. * GUI: CursorHold may trigger before 'updatetime' when using timers. * Crash in setqflist(). * Buffer overflow in :tags command. * Hang when using count() with an empty string. * Reading invalid memory with CTRL-W :. * Using free memory using setloclist(). (Dominique Pelle) * Accessing freed memory in :cbuffer. * Accessing freed memory in :lfile. * Warning for unused function without timers feature. * Crash when searching for a sentence. * Test doesn't search for a sentence. Still fails when searching for start of sentence. (Dominique Pelle)- Updated to revision 1390, fixes the following problems * Balloon shows when cursor is in WinBar. * terminal test hangs, executing abcde. (Stucki) * Cannot drag status line or vertical separator of new terminal window. (UncleBill) * MS-Windows: drawing underline, curl and strike-throw is slow, mFallbackDC not properly updated. * Channel test for callback is flaky. * Shift-Insert doesn't always work in MS-Windows console. * Profile log may be truncated halfway a character. * No error when settting 'renderoptions' to an invalid value before starting the GUI. * CTRL-A does not work with an empty line. (Alex) * Window size wrong after maximizing with WinBar. (Lifepillar) * Cursor in terminal not always updated. * Cannot call a dict function in autoloaded dict. * Autoload script sources itself when defining function. * Configure check for selinux does not check for header file. * When recovering a file with "vim -r swapfile" the hit-enter prompt is at the top of the window. * ch_readraw() waits for NL if channel mode is NL. * Get "no write since last change" message if a terminal is open. * Local additions in help skips some files. (joshklod) * Not enough quickfix help; confusing winid. * Python 3.5 is getting old. * Cannot select modified buffers with getbufinfo(). * Wordcount test is old style. * Char not overwritten with ambiguous width char, if the ambiguous char is single width but we reserve double-width space. * getqflist() items are missing if not set, that makes it more difficult to handle the values. * DirectX scrolling can be slow, vertical positioning is off.- Updated to revision 1365, fixes the following problems * Libvterm ANSI colors can not always be recognized from the RGB values. The default color is wrong when t_RB is empty. * The Terminal highlighting doesn't work in a terminal. * Some users don't want to diff with hidden buffers. * Terminal window colors wrong when using Terminal highlighting. * Recovering does not work when swap file ends in .stz. * There is no easy way to get the window position. * When one channel test fails others fail as well.- Update to revision 1358 * Too many changes to list - Fixes CVE-2017-1000382 bsc#1065958 - Refresh patches: * disable-unreliable-tests.patch * vim-7.3-filetype_spec.patch * vim-7.4-disable_lang_no.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch- Explicitly require python2-devel- Add disable-unreliable-tests.patch to disable unreliable tests bsc#1054723- Bump priorities so we can upgrade from 12.3- Updated to revision 627, fixes the following problems * Call for requesting color and ambiwidth is too early. (Hirohito Higashi) * "1gd" may hang. * Bracketed paste is still enabled when executing a shell command. (Michael Smith) * Can't run make with several jobs, creating directories has a race condition. * The cursor line number becomes negative when using :z^ in an empty buffer. (neovim #6557) * Building the command table requires Perl. * Running parallel make after distclean fails. (Manuel Ortega) * Get only one quickfix list after :caddbuf. * Using freed memory when resetting 'indentexpr' while evaluating it. (Dominique Pelle) * Can't build when configure choses "install-sh". (Daniel Hahler) * Warning for uninitialized variable. (John Marriott) * :simalt on MS-Windows does not work properly. * Duplicate test case for quickfix. * Cannot set the valid flag with setqflist(). * Moving folded text is sometimes not correct. * Illegal memory access with z= command. (Dominique Pelle) * Fold test hangs on MS-Windows. * Memory leak when executing quickfix tests. * Test_options fails when run in the GUI. * No test for mapping timing out. * Configure check for return value of tgetent is skipped. * job_stop() often assumes the channel will be closed, while the job may not actually be stopped. (Martin Gammelsæter) * :simalt still does not work. * Cannot add a context to locations. * Changes to eval functionality not documented. * If a job writes to a buffer and the user is typing a command, the screen isn't updated. When a message is displayed the changed buffer may cause it to be cleared. (Ramel Eshed) * Duplication of code for adding a list or dict return value. * Build failure when windows feature is missing. * Coverity warning for not checking return value of dict_add(). * Crash when complete() is called after complete_add() in 'completefunc'. (Lifepillar) * Off-by-one error in buffer size computation. * Building with gcc 7.1 yields new warnings. * diff mode is insufficiently tested * test_recover fails on some systems. * No test coverage for :spellrepall. * When gF fails to edit the file the cursor still moves to the found line number. * gF test fails on MS-Windows. * gF test fails still on MS-Windows. * The buffer that quickfix caches for performance may become invalid. (Daniel Hahler) * Cannot set the context for a specified quickfix list. * When creating a bufref, then using :bwipe and :new it might get the same memory and bufref_valid() returns true. * Cannot manipulate other than the current quickfix list. * For some people the hint about quitting is not sufficient. * The screen is redrawn when t_BG is set and used to detect the value for 'background'. * When t_u7 is sent a few characters in the second screen line are overwritten and not redrawn later. (Rastislav Barlik) * Package directories are added to 'runtimepath' only after loading non-package plugins. * The conf filetype detection is done before ftdetect scripts from packages that are added later. * float2nr() is not exactly right. * Using % with :hardcopy wrongly escapes spaces. (Alexey Muranov) * When setting the cterm background with ":hi Normal" the value of 'background' may be set wrongly. * Hardcopy test hangs on MS-Windows. * NFA regex engine handles [0-z] incorrectly. * In the GUI, when a timer uses feedkeys(), it still waits for an event. (Raymond Ko) * Since we only support GTK versions that have it, the ckeck for HAVE_GTK_MULTIHEAD is no longer needed. * The ":stag" command does not respect 'switchbuf'. * Using a text object to select quoted text fails when 'selection' is set to "exclusive". (Guraga) * The message "Invalid range" is used for multiple errors. * Warning for unused variable in tiny build. (Tony Mechelynck) * shellescape() always escapes a newline, which does not work with some shells. (Harm te Hennepe) * In the GUI the cursor may flicker. * When 'wrapscan' is off "gn" does not select the whole pattern when it's the last one in the text. (KeyboardFire)- Extend vimrc with mappings for 8-bit controls key escape sequences- Conflict with old vim versions to fix the upgrade from 12.3 boo#1036583- Updated to revision 566, fixes the following problems * :windo allows for ! but it's not supported. * Undefined behavior when using backslash after empty line. * Not enough test coverage for syntax commands. * Crash when getting the window position in tmux. * Cannot detect Bazel BUILD files on some systems. * Using freed memory in :caddbuf after clearing quickfix list. * Setting nocompatible for the tiny version moves the cursor. - Refresh and re-add vim-8.0-ttytype-test.patch- Updated to revision 559, fixes the following problems * Test_edit causes older xfce4-terminal to close. (Dominique Pelle) * Cppcheck warnings. * Edit test may fail on some systems. * Swap file exists briefly when opening the command window. * Extra line break in verbosefile when using ":echomsg". (Ingo Karkat) * Saving the redo buffer only works one time, resulting in the "." command not working well for a function call inside another function call. * No test for the 8g8 command. * Some etags format tags file use 0x01, breaking the parsing. * The typeahead buffer is reallocated too often. * Toupper and tolower don't work properly for Turkish when 'casemap' is empty. (Bjorn Linse) * Toupper/tolower test with Turkish locale fails on Mac. * Toupper and tolower don't work properly for Turkish when 'casemap' contains "keepascii". (Bjorn Linse) * Toupper/tolower test fails on OSX without Darwin. * Getting the window position fails if both the GUI and term code is built in. * GTK: using static gravities is not useful. * The :ownsyntax command is not tested. * Setting ttytype to xxx does not always fail as expected. - Remove vim-8.0-ttytype-test.patch, fixed upstream.- Update the update-alternatives code- Updated to revision 542, fixes the following problems * ml_get errors in silent Ex mode. (Dominique Pelle) * A large count on a normal command causes trouble. (Dominique Pelle) * There is no way to remove quickfix lists (for testing). * Storing a zero byte from a multi-byte character causes fold text to show up wrong. * Character classes are not well tested. They can differ between platforms. * Using a function pointer instead of the actual function, which we know. * GtkForm handling is outdated. * MS-Windows: when 'clipboard' is "unnamed" yyp does not work in a :global command. * dv} deletes part of a multi-byte character. (Urtica Dioica) * Folds are messed up when 'encodin' is "utf-8". * Coverity complains about possible negative value. * RISC OS support was removed long ago, but one file is still included. * When 'wildmenu' is set and 'wildmode' has "longest" then the first file name is highlighted, even though the text shows the longest match. * Line in test commented out. * Buffer overflow when 'columns' is very big. (Nikolai Pavlov) * Test with long directory name fails on non-unix systems. * Test with long directory name fails on Mac. * Abbreviation doesn't work after backspacing newline. (Hkonrk) * Defaults.vim does not work well with tiny features. (crd477) * Memory leak when exiting from within a user function. * Quickfix window not updated when freeing quickfix stack. * Illegal memory access with :z and large count. * No test for falling back to default term value. * Startup test fails on Mac. * Building unit tests fails. * Compiler warning on MS-Windows. * getpos() can return a negative line number. (haya14busa)- Update spec.skeleton with spec-cleaner- Updated to revision 514, fixes the following problems * Insufficient testing for statusline. * 'makeencoding' missing from the options window. * Git and hg see new files after running tests. (Manuel Ortega) * Options test does not always test everything. * Options test fails or hangs on MS-Windows. * 'cinoptions' cannot set indent for extern block. * "make shadow" creates an invalid link. * Quite a few beeps when running tests. * Clang version not correctly detected. * Some functions are not tested. * Running the options test sometimes resizes the terminal. * The packadd test does not create the symlink correctly and does not test the right thing. * The fnamemodify test changes 'shell' in a way later tests may not be able to use system(). * Using ":%argdel" while the argument list is already empty gives an error. (Pavol Juhas) * Not enough test coverage in Insert mode. * Dead code in #ifdef. * Patch shell command uses double quotes around the argument, which allows for $HOME to be expanded. (Etienne) * Terminal width is set to 80 in test3. * Diffpatch fails when the file name has a quote. * Getpgid is not supported on all systems. * The ";" command does not work after characters with a lower byte that is NUL. * Getting font name does not work on X11. * Some macros are in lower case, which can be confusing. * Part of fold patch accidentally included. * v:progpath is not reliably set. * Some macros are in lower case. * Some macros are in lower case. * Adding fold marker creates new comment. * Compiler warnings for comparing unsigned char with 256 always being true. (Manuel Ortega) * The mode test may hang in Test_mode(). (Michael Soyka) * Typo in MinGW test makefile. * Using :move messes up manual folds. * Potential crash if adding list or dict to dict fails. * Old fix for :move messing up folding no longer needed, now that we have a proper solution. * Can't build on HPUX. * Test 45 hangs on MS-Windows. * If an MS-Windows tests succeeds at first and then fails in a way it does not produce a test.out file it looks like the test succeeded. * Resetting 'compatible' in defaults.vim has unexpected side effects. (David Fishburn) * Can't find executable name on Solaris and FreeBSD. * Off-by-one error in using :move with folding. * There are still a few macros that should be all-caps. * Using g< after :for does not show the right output. (Marcin Szamotulski) * After aborting an Ex command g< does not work. (Marcin Szamotulski) * Compiler warnings on MS-Windows. * Not enough testing for help commands. * Exit callback test sometimes fails. * When a test fails and test.log is created, Test_edit_CTRL_I matches it instead of test1.in. * No test covering arg_all(). * The client-server feature is not tested. * Not enough testing for the client-server feature. * Missing change to main.c. * The client-server test may hang when failing. * Tests use assert_true(0) and assert_false(1) to report errors. * remote_peek() is not tested. * The remote_peek() test fails on MS-Windows. * Unnecessary if statement. * The setbufvar() function may mess up the window layout. (Kay Z.) * Illegal memory access when using :all. (Dominique Pelle) * Using :lhelpgrep with an argument that should fail does not produce an error if the previous :helpgrep worked. * Not all windows commands are tested. * Crash and endless loop when closing windows in a SessionLoadPost autocommand. * The autocmd test hangs on MS-Windows. * Running tests leaves an "xxx" file behind. * Clipboard and "* register is not tested. * Splitting a 'winfixwidth' window vertically makes it one column smaller. (Dominique Pelle) * The quotestar test fails when a required feature is missing. * A failing client-server request can make Vim hang. * Crash with cd command with very long argument. * Build failure with older compiler on MS-Windows. * The quotestar test uses a timer instead of a timeout, thus it cannot be rerun like a flaky test. * Insufficient testing for folding. * Arabic support is not fully tested. * Two autocmd tests are skipped on MS-Windows. * taglist() does not prioritize tags for a buffer. * Quotestar test is still a bit flaky. * On MS-Windows ":!start" does not work as expected. * Coverity complains about possible NULL pointer. * Endless loop in updating folds with 32 bit ints. * Looking up an Ex command is a bit slow. * Failed window split for :stag not handled. (Coverity CID 99204) * Can't build with ANSI C. * Client-server tests fail when $DISPLAY is not set. * Coveralls no longer shows per-file coverage. * No link to codecov.io results. * Typo in link to codecov.io results. * Menuage for skipping client-server tests is unclear. * Check for available characters takes too long. * Getting name of cleared highlight group is wrong. (Matt Wozniski) * Script for creating cmdidxs can be improved.- Disable term=xxx test, does not work with any vim version * vim-8.0-ttytype-test.patch- Update apparmor.vim (taken from AppArmor 2.11) * add support for the "kcm" and "qipcrtr" network keywords * update change_profile rule highlighting- Build default vim without X11 support, use update-alternatives to prefer gvim if installed for X11 support.- Updated to revision 425, fixes the following problems * Packadd test does not clean up symlink. * Packadd test uses wrong directory name. * The E11 error message in the command line window is not translated. * The "zero count" error doesn't have a number. (Hirohito Higashi) * Xfontset and guifontwide are not tested. * Illegal memory access after "vapo". (Dominique Pelle) * Restoring help snapshot accesses freed memory. (Dominique Pelle) * GUI test fails on some systems. * Illegal memory access when 'complete' ends in a backslash. * Can't access b:changedtick from a dict reference. * Functions test fails. * Flags of :substitute not sufficiently tested. * Invalid memory access in :recover command. * :recover test fails on MS-Windows. * Illegal memory access with vi' * Not checking return valud of dict_add(). (Coverity) * When using complete() and typing a character undo is saved after the character was inserted. (Shougo) * Double free when compiled with EXITFREE and setting 'ttytype'. * b:changedtick can be unlocked, even though it has no effect. * Unlet command leaks memory. (Nikolai Pavlov) * islocked('d.changedtick') does not work. * Vim relies on limits.h to be included indirectly, but on Solaris 9 it may not be. (Ben Fritz) * When using CTRL-X CTRL-U inside a comment, the use of the comment leader may not work. (Klement) * When building with a shadow directory on macOS lacks the +clipboard feature. * Redrawing errors with GTK 3. * Not enough test coverage for Perl. * No test for concatenating an empty string that results from out of bounds indexing. * The condition for when a typval needs to be cleared is too complicated. * If [RO] in the status line is translated to a longer string, it is trunctted to 4 bytes. * Test to check that setting termcap key fails sometimes. * Using uninitialized memory when 'isfname' is empty. * Leaking memory when setting 'ttytype'. * Crash when setting 'guicursor' to weird value. * Invalid memory access in C-indent code. * 'number' and 'relativenumber' are not properly tested. * Sometimes VimL is used, which is confusing. * GUI initialisation is not sufficiently tested. * Tests fail on MS-Windows. * Travis is too slow to keep up with patches. * ]s does not move cursor with two spell errors in one line. * Might free a dict item that wasn't allocated. * Build fails with tiny features. * If configure defines _LARGE_FILES some include files are included before it is defined. * Not all options are tested with a range of values. * The 'balloondelay', 'ballooneval' and 'balloonexpr' options are not defined without the +balloon_eval feature. Testing that an option value fails does not work for unsupported options. * Invalid memory access when setting wildchar empty. * Leaking memory when setting v:completed_item. * More options are not always defined. * Build fails without +folding. * Invalid memory access when using :sc in Ex mode. (Dominique Pelle) * The "+ register is not tested. * Size computations in spell file reading are not exactly right. * Possible overflow when reading corrupted undo file. CVE-2017-6349 bsc#1027057 * Another possible overflow when reading corrupted undo file. CVE-2017-6350 bsc#1027053 * CTRL-Z and mouse click use CTRL-O unnecessary. * With 'linebreak' set and 'breakat' includes ">" a double-wide character results in "<<" displayed. * Diff mode is not sufficiently tested. * Warning in tiny build for unused variable. (Tony Mechelynck) * Misplaced #ifdef. (Christ van Willigen) * Timer test failed for no apparent reason. * No tests for arabic. * Tiny build has a problem with generating the options test. * compiler warnings * filtering lines through "cat", without changing the line count, changes manual folds. * Test for arabic does not check what is displayed. * When the window scrolls horizontally when the popup menu is displayed part of it may not be cleared. (Neovim issue #6184) * Arabic support is verbose and not well tested. * GUI test fails with Athena and Motif. * When the same tag appears more than once, the order is unpredictable. (Charles Campbell) * Tabs are not aligned when scrolling horizontally and a Tab doesn't fit. (Axel Bender) * Testing the + register fails with Motif. * 'balloonexpr' only works synchronously. * Cannot build with the viminfo feature but without the eval feature. * Illegal memory access with "t". * Crash when using balloon_show() when not supported. (Hirohito Higashi) * Some tests have a one second delay. * Test fails with missing balloon feature. * :map completion does not have . (Dominique Pelle) * GUI tests may fail. * Not enough testing for quickfix. * v:progpath may become invalid after ":cd". * The arabic shaping code is verbose. * Filtering folds with marker method not tested. * Updating folds does not work properly when inserting a file and a few other situations. * set_progpath is defined but not always used * Newer gettext/iconv library has extra dll file. * We can't change the case in menu entries, it breaks translations. * Menu test fails on MS-Windows. * Menu test fails on MS-Windows using gvim. * Balloon eval is not tested. * Balloon test fails on MS-Windows. * Setting v:progpath is not quite right. * Test for the clipboard fails sometimes. * ASAN logs are disabled and don't cause a failure. * Test for v:progpath fails on MS-Windows. * When running :make the output may be in the system encoding, different from 'encoding'. * Diff mode is displayed wrong when adding a line at the end of a buffer. * Python test fails with Python 3.6. * The effect of adding "#" to 'cinoptions' is not always removed. * Compiler warnings on MS-Windows. (Ajit Thakkar) * Build errors when building without folding. - Drop test87-python36.patch, fixed upstream.- Add test87-python36.patch to update test results for Python 3.6- Updated to revision 324, fixes the following problems * When a json message arrives in pieces, the start is dropped and the decoding fails. * Not enough testing for GUI functionality. * getcmdtype(), getcmdpos() and getcmdline() are not tested. * ":help :[range]" does not work. (Tony Mechelynck) * ":help z?" does not work. (Pavol Juhas) * No test for setting 'guifont'. * Small mistake in 7x13 font name. * Insert mode completion does not respect "start" in 'backspace'. * Warning for unused variable with small build. * When using the tiny version trying to load the matchit plugin gives an error. On MS-Windows some default mappings fail. * Possible overflow with spell file where the tree length is corrupted. CVE-2017-5953 bsc#1024724 * When running the command line tests there is a one second wait. * Illegal memory access with "1;y".- Updated to revision 311, fixes the following problems * Double free on exit when using a closure. (James McCoy) * Ex command range with repeated search does not work. (Bruce DeVisser) * When the GUI window is resized Vim does not always take over the new size. (Luchr) * Cannot stop diffing hidden buffers. (Daniel Hahler) * No tests for ":set completion" and various errors of the :set command. * Cannot set terminal key codes with :let. * Bracketed paste does not work in Visual mode. * Assign test fails in the GUI. * Invalid memory access when option has duplicate flag. * mode() not sufficiently tested. * Asan detects a memory error when EXITFREE is defined. (Dominique Pelle) * When using a symbolic link, the package path will not be inserted at the right position in 'runtimepath'. (Dugan Chen, Norio Takagi) * Cannot use an empty key in json. * Not enough testing for GUI functionality. * Linebreak tests are old style.- Updated to revision 296, fixes the following problems * Jumping to a tag that is a static item in the current file fails. (Kazunobu Kuriyama) * The test for :profile is slow and does not work on MS-Windows. * On MS-Windows the system() test skips a few parts. * Some syntax arguments take effect even after "if 0". (Taylor Venable) * Warning for an unused parameter when the libcall feature is disabled. Warning for a function type cast when compiling with -pedantic. * Some syntax arguments are not tested. * When completing a group name for a highlight or syntax command cleared groups are included. * No test for invalid syntax group name. * Order of complication flags is sometimes wrong. * Compiler warns for uninitialized variable. (Tony Mechelynck) * After :undojoin some commands don't work properly, such as :redo. (Matthew Malcomson) * Test coverage for :retab insufficient. * Leaking file descriptor when system() cannot find the buffer. (Coverity) * Internally used commands for CTRL-Z and mouse click end up in history. (Matthew Malcomson) * When using :substitute with the "c" flag and 'cursorbind' is set the cursor is not updated in other windows. * Vim does not support bracketed paste, as implemented by xterm and other terminals. * Build fails if the multi-byte feature is disabled. * The buffer used to store a key name theoreticaly could be too small. (Coverity) * The Netbeans "specialKeys" command does not check if the argument fits in the buffer. (Coverity) * Leaking memory when syntax cluster id is unknown. (Coverity) * When a Cscope line contains CTRL-L a NULL pointer may be used. (Coverity) * When decoding JSON with a JS style object the JSON test may use a NULL pointer. (Coverity) * Build fails without the cscope feature. * No command line completion for :cexpr, :cgetexpr, :caddexpr, etc. * Ubsan reports errors for integer overflow. * Completion for :match does not show "none" and other missing highlight names. * Checking if PROTO is defined inside a function has no effect. * When a multi-byte character ends in a zero byte, putting blockwise text puts it before the character instead of after it. * Coverity gets confused by the flags passed to find_tags() and warnts for an uninitialized variable. * When 'fileformats' is changed in a BufReadPre auto command, it does not take effect in readfile(). (Gary Johnson) * When a block is visually selected and put is used on the end of the selection only one line is changed. * The test for patch 8.0.0224 misses the CR characters and passes even without the fix. (Christian Brabandt) * Crash when 'fileformat' is forced to "dos" and the first line in the file is empty and does not have a CR character. * When pasting test in an xterm on the command line it is surrounded by and . (Johannes Kaltenbach) * When freeing a buffer the local value of the 'formatprg' option is not cleared. * When using bracketed paste line breaks are not respected. * There are no tests for bracketed paste mode. * Pasting in Insert mode does not work when bracketed paste is used and 'esckeys' is off. * The paste test fails if the GUI is being used. * When several lines are visually selected and one of them is short, using put may cause a crash. (Axel Bender) * Memory leak detected when running tests for diff mode. * Gcc complains that a variable may be used uninitialized. Confusion between variable and label name. (John Marriott) * When setting wildoptions=tagfile the completion context is not set correctly. (desjardins) * When using bracketed paste autoindent causes indent to be increased. * The address sanitizer sometimes finds errors, but it needs to be run manually. * The clang build on CI fails with one configuration. * Vim defines a mch_memmove() function but it doesn't work, thus is always unused. * Completion of user defined functions is not covered by tests. * When making a character lower case with tolower() changes the byte cound, it is not made lower case. * When the user sets t_BE empty after startup to disable bracketed paste, this has no direct effect. * The generated zh_CN.cp936.po message file is not encoded properly. * Compiler warnings for int to pointer conversion. * Under some circumstances, one needs to type Ctrl-N or Ctrl-P twice to have a menu entry selected. (Lifepillar) * vim_strcat() cannot handle overlapping arguments. * When two submits happen quick after each other, the tests for the first one may error out. * When virtcol() gets a column that is not the first byte of a multi-byte character the result is unpredictable. (Christian Ludwig) * It is not so easy to write a script that works with both Python 2 and Python 3, even when the Python code works with both. * Characters below 256 that are not one byte are not always recognized as word characters. * When creating a session when winminheight is 2 or larger and loading that session gives an error. * When using an assert function one can either specify a message or get a message about what failed, not both. * When calling setpos() with a buffer argument it often is ignored. (Matthew Malcomson) * Tests fail because some changes were not included. * The keyword test file is not included in the archive. * The keyword test file is not included in the archive. * Tab commands do not handle count correctly. (Ken Hamada) * Build fails with tiny features. * Not enough test coverage for eval functions. * Farsi support is barely tested. * Farsi support is not tested enough. * Memory error reported by ubsan, probably for using the string returned by execute(). * May get ml_get error when :pydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * Compiler warning for using uninitialized variable. * A channel test sometimes fails on Mac. * May get ml_get error when :luado deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :perldo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :rubydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :tcldo deletes lines or switches to another buffer. (Nikolai Pavlov, closes #1421) * Crash on exit is not detected when running tests. * Dead code detected by Coverity when not using gnome. * When update_single_line() is called recursively, or another screen update happens while it is busy, errors may occur. * When checking for CTRL-C typed the GUI may detect a screen resize and redraw the screen, causing trouble. * Checking for FEAT_GUI_GNOME inside GTK 3 code is unnecessary. * The GUI test may trigger fontconfig and take a long time. * GUI test fails on MS-Windows. * With MSVC 2015 the dll name is vcruntime140.dll. * On MS-Windows setting an environment variable with multi-byte strings does not work well. * MS-Windows files are still using ARGSUSED while most other files have UNUSED. * When doing a Visual selection and using "I" to go to insert mode, CTRL-O needs to be used twice to go to Normal mode. (Coacher) * The return value of mode() does not indicate that completion is active in Replace and Insert mode. (Zhen-Huan (Kenny) Hu) * The Test_collapse_buffers() test failed once, looks like it is flaky. * Tests fail with tiny build on Unix. * When concealing is active and the screen is resized in the GUI it is not immediately redrawn. * Cannot access the arguments of the current function in debug mode. (Luc Hermitte) * Errors reported while running tests. * No test for "ga" and :ascii. * If a wide character doesn't fit at the end of the screen line, and the line doesn't fit on the screen, then the cursor position may be wrong. (anliting) * Visual block insertion does not insert in all lines. * The stat test is a bit slow. * Some tests have a one or three second wait. * Argument list is not stored correctly in a session file. (lgpasquale) * test_viml hangs. * Bracketed paste can only append, not insert.- Improve summary bsc#1021040- Add missing %changelog to spec.skeleton- Updated to revision 194, fixes the following problems * When compiling with EBCDIC defined the build fails. (Yaroslav Kuzmin) * For completion "locale -a" is executed on MS-Windows, even though it most likely won't work. * Setting language in gvim on MS-Windows does not work when libintl.dll is dynamically linked with msvcrt.dll. * Using :change in between :function and :endfunction fails. * When opening a buffer on a directory and inside a try/catch then the BufEnter event is not triggered. * test_command_count may fail when a previous test interferes, seen on MS-Windows. * 'formatprg' is a global option but the value may depend on the type of buffer. (Sung Pae) * Error E937 is used both for duplicate key in JSON and for trying to delete a buffer that is in use. * When 'cursorbind' and 'cursorcolumn' are both on, the column highlignt in non-current windows is wrong. * When 'cursorbind' and 'cursorline' are set, but 'cursorcolumn' is not, then the cursor line highlighting is not updated. (Hirohito Higashi) * Ubsan warns for using a pointer that is not aligned. * When in Ex mode and an error is caught by try-catch, Vim still exits with a non-zero exit code. * The system() test fails on MS-Windows. * The error message from assert_notequal() is confusing. * Building with a new Ruby version fails. * Using NOT_VALID for redraw_later() to update the cursor line/column highlighting is not efficient. * There are no tests for the :profile command. * Detecting duplicate tags uses a slow linear search. * Some systems do not have ruby_sysinit(), causing the build to fail. * Build fails with tiny features. * Accidentally removed #ifdef. * Profile tests fails if total and self time are equal.- Updated to revision 172, fixes the following problems * When a C preprocessor statement has two line continuations the following line does not have the right indent. (Ken Takata) * ":earlier" and ":later" do not work after startup or reading the undo file. * When the pattern of :filter does not have a separator then completion of the command fails. * To pass buffer content to system() and systemlist() one has to first create a string or list. * Running the channel test creates channellog. * system() test fails on MS-Windows. * system() test fails on OS/X. * When sorting zero elements a NULL pointer is passed to qsort(), which ubsan warns for. * Several float functions are not covered by tests. * No command line completion for ":syntax spell" and ":syntax sync". * On MS-Windows some float functions return a different value when passed unusual values. strtod() doesn't work for "inf" and "nan". * Using a NULL pointer when using feedkeys() to trigger drawing a tabline. * EMSG() is sometimes used for internal errors. * Build fails when using small features. * Build error on Fedora 23 with small features and gnome2. * Ruby 2.4 no longer supports rb_cFixnum. * Outdated and misplaced comments. * Ubsan warns for integer overflow. * JSON with a duplicate key gives an internal error. (Lcd) * str2nr() and str2float() do not always work with negative values. * Still some float functionality is not covered by tests. * For complicated string json_decode() may run out of stack space. * Channel test fails for using freed memory. * JS style JSON does not support single quotes. * The command selected in the command line window is not executed. (Andrey Starodubtsev)- Updated to revision 147, fixes the following problems * Not enough test coverage for syntax commands. * Test fails because of using :finish. * "2;'(" causes ml_get errors in an empty buffer. * Null pointer access reported by UBsan. * An address relative to the current line, ":.,+3y", does not work properly on a closed fold. * When using indent folding and changing indent the wrong fold is opened. * When 'maxfuncdepth' is set above 200 the nesting is limited to 200. * Small build fails. * Warning for unused argument. * Pasting inserted text in Visual mode does not work properly. * Nested function test fails on AppVeyor. * Normal colors are wrong with 'termguicolors'. * Line number of current buffer in getbufinfo() is wrong. * When using MSVC the GvimExt directory is cleaned twice. * Running tests on MS-Windows is a little bit noisy. * When using 'termguicolors' on MS-Windows the RGB definition causes the colors to be wrong. * searchpair() does not work when 'magic' is off.- Updated to revision 130, fixes the following problems * Not enough testing for entering Ex commands. * Display problem with 'foldcolumn' and a wide character. (esiegerman) * Cancelling completion still inserts text when formatting is done for 'textwidth'. (lacygoill) * Display test fails on MS-Windows. * Parallel make still doesn't work. (Lewis Muir) * Configure uses "ushort" while the Vim code doesn't.- Updated to revision 124, fixes the following problems * May not process channel readahead. (skywind) * Value of 'thesaurus' option not checked properly. * When using ch_read() with zero timeout, can't tell the difference between reading an empty line and nothing available. * Cannot use a semicolon in 'backupext'. (Jeff) * When reading channel output in a timer, messages may go missing. (Skywind) * The channel "drop" option is not tested. * Still checking if memcmp() exists while every system should have it now. * Drop command doesn't use existing window. * The :history command is not tested. * Tests 92 and 93 are old style. * When reading English help and using CTRl-] the language from 'helplang' is used. * Parallel make fails. (J. Lewis Muir) * No test for using CTRL-R on the command line. * Setting 'cursorline' changes the curswant column. (Daniel Hahler) * Internal error for assert_inrange(1, 1).- Updated to revision 101, fixes the following problems * When the input or output is not a tty Vim appears to hang. * When a channel callback consumes a lot of time Vim becomes unresponsive. (skywind) * Can't build on MS-Windows. * Popup menu always appears above the cursor when it is in the lower half of the screen. (Matt Gardner) * Options that are a file name may contain non-filename characters. * Some options are not strictly checked. * (after 8.0.0101) cannot set 'dictionary' to a path- Updated to revision 95, fixes the following problems * Problems with GTK 3.22.2 fixed in 3.22.4.- Export "TERM=linux" before running the test suite: vim does quite an extensive test relying on a full fledged terminal inside OBS, stdio is redirected to a serial console (where the build log is being recorded/extracted. Systemd set non-local tty by default to vt220 in upcoming versions (which the vi test suite fails to run on; this should be considered a vim bug).- Updated to revision 92, fixes the following problems * Using NUL instead of NULL. * Crash when using the preview window from an unnamed buffer. (lifepillar) * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * When a match ends in part of concealed text highlighting, it might mess up concealing by resetting prev_syntax_id. * An exiting job is detected with a large latency. * New code for job_stop() breaks channel test on AppVeyor. * Conceal test passes even without the bug fix. * No test for what 8.0.0047 fixes. * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * Minor comment and style deficiencies. * When setting 'filetype' there is no check for a valid name. * Tests fail without the 'keymap' features. * Positioning of the popup menu is not good. * Vim does not build on VMS systems. * When using an Ex command for 'keywordprg' it is escaped as with a shell command. (Romain Lafourcade) * Compiler warning for unused variable. * No digraph for HORIZONTAL ELLIPSIS. * Compiler warning for comparing with unsigned. (Zoltan Arpadffy) * Normal test fails on MS-Windows. * Compiler warning for unused function in tiny build. (Tony Mechelynck) * when calling an operator function when 'linebreak' is set, it is internally reset before calling the operator function. * VMS has a problem with infinity. * Checking did_throw after executing autocommands is wrong. (Daniel Hahler) * Compiler warning for self-comparison. * Tests referred in Makefile that no longer exist. * Exit value from a shell command is wrong. (Hexchain Tong) * MS-Windows: Crash with long font name. (Henry Hu) * More comparisons between firstwin and lastwin. * Cannot make Vim fail on an internal error. * Using number for exception type lacks type checking. * Channel log has double parens ()(). * The GUI code is not tested by Travis. * Accessing freed memory in quickfix. * Accessing freed memory in quickfix. (Domenique Pelle) * The OS X build fails on Travis. * Inconsistent function names. * Extension for configure should be ".ac". * Using freed memory with win_getid(). (Domenique Pelle) * Using freed memory when adding to a quickfix list. (Domenique Pelle) * Using freed memory with recursive function call. (Dominique Pelle) * Cannot add a comment after ":hide". (Norio Takagi) * When the channel callback gets job info the job may already have been deleted. (lifepillar) * When a test fails in Setup or Teardown the problem is not reported. * Various problems with GTK 3.22.2. * Cursor moved after last character when using 'breakindent'. * Test_help_complete sometimes fails in MS-Windows console. * C indenting does not support nested namespaces that C++ 17 has. - Drop bsc-1008800.patch, fixed upstream.- Add bsc-1008800.patch to fix gvim rendering with recent gtk+ update. Fixes bsc#1008800. Patch by Jan Alexander Steffens.- Updated to revision 45, fixes the following problems * Cannot use overlapping positions with matchaddpos(). * No completion for ":messages". * Order of matches for 'omnifunc' is messed up. (Danny Su) * Detecting that a job has finished may take a while. * Get E924 when switching tabs. * OPEN_CHR_FILES not defined for FreeBSD using Debian userland files. * When Vim 8 reads an old viminfo and exits, the next time marks are not read from viminfo. (Ned Batchelder) * Whole line highlighting with matchaddpos() does not work. * When using Insert mode completion but not actually inserting anything an undo item is still created. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" change is not saved for undo. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" with CTRL-N the change is not saved for undo. (Tommy Allen) * In diff mode the cursor may end up below the last line, resulting in an ml_get error. * Calling job_stop() right after job_start() does not work.- Updated to revision 32, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy) * A string argument for function() that is not a function name results in an error message with NULL. (Christian Brabandt) * Netbeans test fails with Python 3. (Jonathonf) * ":lb" is interpreted as ":lbottom" while the documentation says it means ":lbuffer". * Vim 7.4 is still mentioned in a few places. * Popup complete test is disabled. * Unnecessary workaround for AppVeyor. * Crash when editing file that starts with crypt yeader. (igor2x) * On OSX Test_pipe_through_sort_all() sometimes fails. * Typos in comments. * Missing comma in list. * Crypt tests are old style. * Can't tell which part of a channel has "buffered" status. * Build fails. * Cannot get the number of the current quickfix or location list. * When using ":sleep" channel input is not handled. * Test_command_count is old style. * The regexp engines are not reentrant. * In the GUI when redrawing the cursor it may be on the second half of a double byte character. * If a channel in NL mode is missing the NL at the end the remaining characters are dropped. * "gd" and "gD" may find a match in a comment or string. * When the netbeans channel closes, "DETACH" is put in the output part. (Ozaki Kiichi) * Inconsistent use of spaces vs tabs in gd test. * Error format with %W, %C and %Z does not work. (Gerd Wachsmuth) * A channel is closed when reading on stderr or stdout fails, but there may still be something to read on another part. * Superfluous semicolons. * Code for MS-Windows is complicated because of the exceptions for old systems. * Mouse mode is not automatically detected for tmux. * After ":bwipeout" 'fileformat' is not set to the right default.- Updated to revision 3, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy)- Updated to revision 2, fixes the following problems * Intro screen still mentions version7. (Paul) * The netrw plugin does not work.- Update to version 8.0 * Crash on exit when EXITFREE is defined. (Dominique Pelle) * Valgrind reports using uninitialzed memory. (Dominique Pelle) * Test 86 and 87 fail with some version of Python. * Netbeans test fails when run from unpacked MS-Windows sources. * Netbeans test fails in shadow directory. * Not enough test coverage for Normal mode commands. * The example that explains nested backreferences does not work properly with the new regexp engine. (Harm te Hennepe) * Regexp fails to match when using "\>\)\?". (Ramel) * Reading past end of line when using previous substitute pattern. (Dominique Pelle) * Attempt to read history entry while not initialized. * Compiler warnings with Solaris Studio when using GTK3. * Memory leak in timer_start(). * Invalid memory access when formatting. (Dominique Pelle) * Checking for last_timer_id to overflow is not reliable. (Ozaki Kiichi) * Illegal memory access with ":1@". (Dominique Pelle) * Superfluous function prototypes. * Sort test sometimes fails. * Needless line break. Confusing directory name. * MS-Windows gvim.exe does not have DirectX support. * Test runner misses a comma.- Updated to revision 2347, fixes the following problems * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails. * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind. * taglist() is slow. (Luc Hermitte) * Running normal mode tests leave a couple of files behind. (Yegappan Lakshmanan) * taglist() is still slow. (Luc Hermitte) * Can't build with small features. (John Marriott) * Tab page test fails when run as fake root. * MS-Windows: Building with Ruby uses old version. * Tiny things. Test doesn't clean up properly. * Typo in MS-Windows build script. * Too many old style tests. * The "Reading from channel output..." message can be unwanted. Appending to a buffer leaves an empty first line behind. * For MinGW RUBY_API_VER_LONG isn't set correctly. Many default version numbers are outdated. * Autocommand test fails when run directly, passes when run as part of test_alot.- Updated to revision 2334, fixes the following problems * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind.- Updated to revision 2295, fixes the following problems * The field names used by getbufinfo(), gettabinfo() and getwininfo() are not consistent. * Tab page tests are old style. * Test files have inconsistant modelines. * Startup test fails on Solaris. * There is no equivalent of 'smartcase' for a tag search. * ":oldfiles" output is a very long list. * The default ttimeoutlen is very long. * Crash when using funcref() with invalid name. (Dominique Pelle) * Can't build with +eval but without +quickfix. (John Marriott) * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails.- Updated to revision 2225, fixes the following problems * When using matchaddpos() a character after the end of the line can be highlighted. * Can't build with +timers when +digraph is not included. * Recursive call to substitute gets stuck in sandbox. * printf() gives an error when the argument for %s is not a string. * printf() does not support binary format. * Sourcing a script where a character has 0x80 as a second byte does not work. * Buffer overflow when using latin1 character with feedkeys(). * Compiler warnings with older compiler and 64 bit numbers. * Crash when placing a sign in a deleted buffer.- Updated to revision 2216, fixes the following problems * The qf_init_ext() function is too big. * Compiler warning for initializing a struct. * There is still code and help for unsupported systems. * There is no way to get a list of the error lists. * When using ":vimgrep" may end up with duplicate buffers. * No proper testing of trunc_string(). * Coverage report is messed up by the unittests. * Can't run scripttests in the top directory. * Wrong part of #ifdef removed. * eval.c is too big. * Build fails. * eval.c is too big. * eval.c is too big. * Non-Unix builds fail. * Wrong file name. * qf_init_ext() is too big. * Using dummy variable to compute struct member offset. * eval.c is still too big. * Coverity warns for possible buffer overflow. * Compiler warns for uninitialzed variable. (John Marriott) * getcompletion() not well tested. * Compiler warning for char/char_u conversion. * Not all arguments of trunc_string() are tested. Memory access error when running the message tests. * spell.c is too big. * Missing change to include file. * The return value of type() is difficult to use. * substitute() does not support a Funcref argument. * rgb.txt is read for every color name. * One more place using a dummy variable. * No autocommand event to initialize a window or tab page. * Syntax error when dict has '>' key. * Cannot update 'tabline' when a tab was closed. * Running checks in po diretory fails. * Netbeans test fails on non-Unix systems. * When using PERROR() on some systems assert_fails() does not see the error. * Line numbers in the error list are not always adjusted. * Not much test coverage for digraphs. * Coverity complains about not restoring a value. * New digraph test makes testing hang. * Digraph tests fails on some systems. * Using the system default encoding makes tests unpredictable. * Digraph code test coverage is still low. * Keymap test fails with normal features. * Color handling of X11 GUIs is too complicated. * Using submatch() in a lambda passed to substitute() is verbose. * Coverity reports a resource leak when out of memory. * GTK 3 build fails with older GTK version. * Netbeans test fails once in a while. Leaving log file behind. * The color allocation in X11 is overly complicated. * Man test fails when run with the GUI. * Lambda functions show up with completion. * Warning from 64 bit compiler. * Text object tests are old style. * When a keymap is active only "(lang)" is displayed. * "cgn" and "dgn" do not work correctly with a single character match and the replacement includes the searched pattern. * Looping over windows, buffers and tab pages is inconsistant. * Tiny build with GUI fails. * Can't have "augroup END" right after ":au!". * Code duplication when unreferencing a function. * Configure reports default features to be "normal" while it is "huge". * Clang warns about missing field in initializer. * Misplaced equal sign. * Netbeans test is flaky. * Setting 'display' to "lastline" is a drastic change, while omitting it results in lots of "@" lines. * When there is an CmdUndefined autocmd then the error for a missing command is E464 instead of E492. (Manuel Ortega) * Defaults are very conservative. * getcompletion(.., 'dir') returns a match with trailing "*" when there are no matches. * Test for undo is flaky. * Tiny build fails. * Loading defaults.vim with -C argument. * The default vimrc for Windows is very conservative. * Deleting an augroup that still has autocmds does not give a warning. The next defined augroup takes its place. * Mac: can't build with tiny features. * Closures are not supported. * User defined functions can't be a closure. * No easy way to check if lambda and closure are supported. * Mac: don't get +clipboard in huge build. * No new style test for diff mode. * diffmode test leaves files behind, breaking another test. * Compiler warning for loss of data. * No tests for :diffget and :diffput * The short form of ":noswapfile" is ":noswap" instead of ":nos". * Memory leak when saving for undo fails. * Memory leak when using timer_start(). (Dominique Pelle) * Pending timers cause false memory leak reports. * More memory leaks when using partial, e.g. for "exit-cb". * test_partial has memory leaks reported. * Can't build with tiny features. * No error for using function() badly. * Various tiny issues. * Closure function fails. * Using function() with a name will find another function when it is redefined. * Test 86 and 87 fail. * :delfunction causes illegal memory access. * Tiny build fails. * Coverity reports bogus NULL check. * Leaking memory when redefining a function. * A funccal is garbage collected while it can still be used. * On MS-Windows quickix does not handle a line with 1023 bytes ending in CR-LF properly. * Win32: Using CreateThread/ExitThread is not safe. * Not enough testing for popup menu. CTRL-E does not always work properly. * test_alot fails. * Not much testing for cscope. * If a test leaves a window open a following test may fail. * Warning with MinGW 64. (John Marriott) * Quickfix test fails on MS-Windows. * No proper translation of messages with a count. * GUI test isn't testing much. * Test_communicate() fails sometimes. * Quotes make GUI test fail on MS-Windows. * Compiler warning. * Test_job_start_fails() is expected to report memory leaks, making it hard to see other leaks in test_partial. * Result of getcompletion('', 'cscope') depends on previous completion. * Insufficient testing for cscope. * setmatches() mixes up values. (Nikolai Pavlov) * Expression test fails without conceal feature. * Result of getcompletion('', 'sign') depends on previous completion. * match() and related functions tested with old style test. * It is not possible to use plugins in an "after" directory to tune the behavior of a package. * Startup test fails on MS-Windows. * Small build can't run startup test. * Small build can't run tests. * Not running the startup test on MS-Windows. * Startup test gets stuck on MS-Windows. * Cannot get information about timers. * MS-Windows build fails. * No test for "vim --help". * Can't test help on MS-Windows. * Adding duplicate flags to 'whichwrap' leaves commas behind. * Insufficient testing of cscope. * #ifdefs in main() are complicated. * No testing for -C and -N command line flags, file arguments, startuptime. * No test for reading from stdin. * Reading from stdin test fails on MS-Windows. * There is no easy way to stop all timers. There is no way to temporary pause a timer. * Compiler warning for unused variable. * Color Grey40 used in startup but not in the short list. * Sign tests are old style. * Tests that use RunVim() do not actually perform the test. * Test glob2regpat does not test much. * Timers test is flaky. * glob2regpat test fails on Windows. * Completion does not work properly with some plugins. * Cannot detect encoding in a fifo. * When startup test fails it's not easy to find out why. GUI test fails with Gnome. * No automatic prototype for vim_main2(). * Generating prototypes with Cygwin doesn't work well. * With Gnome when the GUI can't start test_startup hangs. * Sign tests don't cover enough. * MS-Windows: The vimrun program does not support Unicode. * glob2regpat test doesn't test everything on MS-Windows. * All functions are freed on exit, which may hide leaks. * Test alot sometimes fails under valgrind. (Dominique Pelle) * In the GUI the cursor is hidden when redrawing any window, causing flicker. * Cannot get all information about a quickfix list. * The sign column disappears when the last sign is deleted. * Build fails with small features. * Test fails with normal features. * It is not easy to get information about buffers, windows and tabpages. * 'wildignore' always applies to getcompletion(). * Warning for unused function. * The +xpm feature is not sorted properly in :version output. * Test for mappings is old style. * Cannot map . (Stephen Riehm) * On OSX configure mixes up a Python framework and the Unix layout. * Mouse support is not automatically enabled with simple term. * Mark " is not set when closing a window in another tab. (Guraga) * Cannot highlight the "~" lines at the end of a window differently. * A font that uses ligatures messes up the screen display. * It's not easy to find out if a window is a quickfix or location list window. * Test fails without the +sign feature.- Updated to revision 2045, fixes the following problems * Looking up a buffer by number is slow if there are many. * Netbeans file authentication not tested. * GTK: display updating is not done properly and can be slow. * setbufvar() causes a screen redraw. * filter() and map() either require a string or defining a function. * Memory leak when using a function callback.- Updated to revision 2033, fixes the following problems * Memory access error when reading viminfo. (Dominique Pelle) * "gd" hangs in some situations. (Eric Biggers) * Not all quickfix tests are also done with the location lists. * Background is not drawn properly when 'termguicolors' is set. * Coverity warns for unreachable code. * Win32: Cannot compile with XPM feature using VC2015 * The Man plugin doesn't work that well. * File list does not include new XPM libraries. * Viminfo continuation line with wrong length isn't skipped. (Marius Gedminas) * Using Ctrl-A with double-byte encoding may result in garbled text. * Minor problems with the quickfix code. * Quickfix long lines test not executed for buffer. * Ruby test is old style. * Cscope interface does not support finding assignments. * Not all parts of the quickfix code are tested. * No test for what 7.4.1948 fixes. * Using 32-bit Perl with 64-bit time_t causes memory corruption. (Christian Brabandt) * When using CTRL-W f and pressing "q" at the ATTENTION dialog the newly opened window is not closed. * Perl interface has obsolete workaround. * Perl interface preprocessor statements not nicely indented. * Crash when running test_channel.vim on Windows. * Unicode standard 9 was released. * When 'insertmode' is reset while doing completion the popup menu remains even though Vim is in Normal mode. * Two test files for increment/decrement. * Running Win32 Vim in mintty does not work. * The quickfix init function is too big. * When using a job in raw mode to append to a buffer garbage characters are added. * Coverity reports a resource leak. * Falling back from NFA to old regexp engine does not work properly. (fritzophrenic) * Invalid memory access with "\. * When the netbeans channel is closed consuming the buffer may cause a crash. * Using ":insert" in an empty buffer sets the jump mark. (Ingo Karkat) * It is not easy to see unrecognized error lines below the current error position. * On Solaris select() does not work as expected when there is typeahead. * GUI has a problem with some termcodes. * On MS-Windows large files (> 2Gbyte) cause problems. * Number variables are not 64 bits while they could be. * With 64 bit changes don't need three calls to sprintf(). * Large file test does not delete its output. * Getting value of binary option is wrong. (Kent Sibilev) * 'errorformat' is parsed for every call to ":caddexpr". Can't add to two location lists asynchronously. * No testing for Farsi code. * Viminfo file contains duplicate change marks. * farsi.c and arabic.c are included in a strange way. * Not all quickfix features are tested. * Missing changes in VMS build file. * Compiler warns for loss of data. * When copying unrecognized lines for viminfo, end up with useless continuation lines. * When updating viminfo with file marks there is no time order. * filter() and map() only accept a string argument. * Cscope items are not sorted. * glob() does not add a symbolic link when there are no wildcards. * Values for true and false can be confusing. * Not all TRUE and FALSE arguments are tested. * True-false test fails. * GUI: cursor drawn in wrong place if a timer callback causes a screen update. (David Samvelyan) * Capturing the output of a command takes a few commands. * Cannot easily scroll the quickfix window. * When writing buffer lines to a job there is no NL to NUL conversion. * evalcmd() doesn't work recursively. * Evalcmd test fails. * Tiny build fails. (Tony Mechelynck) * Crash when passing number to filter() or map(). * Still cursor flickering when a callback updates the screen. (David Samvelyan) * GUI: cursor displayed in the wrong position. * After using evalcmd() message output is in the wrong position. (Christian Brabandt) * Crash when using tabnext in BufUnload autocmd. (Norio Takagi) * Running the tests leaves a viminfo file behind. * evalcmd() has a confusing name. * Messages test fails. * There is a :cbottom command but no :lbottom command. * It is not easy to get a list of command arguments. * Test for getcompletion() does not pass on all systems. * Using "noinsert" in 'completeopt' breaks redo. * Using "noinsert" in 'completeopt' does not insert match. * When a file gets a name when writing it 'acd' is not effective. (Dan Church) * Warning from MinGW about _WIN32_WINNT redefined. (John Marriott) * When there are many errors adding them to the quickfix list takes a long time. * buf_valid() can be slow when there are many buffers. * When ignoring case utf_fold() may consume a lot of time. * Can't build without +autocmd feature. * Still too many buf_valid() calls. * Warnings from 64 bit compiler. * buflist_findname_stat() may find a dummy buffer. * More buf_valid() calls can be optimized. * The cursor blinking stops or is irregular when receiving date over a channel and writing it in a buffer, and when updating the status. * Reference counting for callbacks isn't right. * Can't build with +eval but without +menu. * cppcheck warns for using index before limits check. * printf() does not work with 64 bit numbers. * ARCH must be set properly when using MinGW. * The list_lbr_utf8 test fails if ~/.vim/syntax/c.vim sets 'textwidth' to a non-zero value. * Build fails with 64 bit MinGW. (Axel Bender) * 'cscopequickfix' option does not accept new value "a".- Updated to revision 1938, fixes the following problems * Updating marks in a quickfix list is very slow when the list is long. * When waiting for a character is interrupted by receiving channel data and the first character of a mapping was typed, the mapping times out. * When receiving channel data 'updatetime' is not respected. * Wrong computation of remaining wait time in RealWaitForChar() * When umask is set to 0177 Vim can't create temp files. * GUI: When channel data is received the cursor blinking is interrupted. * Channel reading very long lines is slow. * balloon eval only gets the window number, not the ID. * Cannot easily get the window ID for a buffer. * Cannot get the window ID for a mouse click. * Cannot use a window ID where a window number is expected. * Invoking mark_adjust() when adding a new line below the last line is pointless. * Various typos, long lines and style mistakes. * User commands don't support modifiers. * GTK 3: cursor blinking doesn't work well. * Using CTRL-] in the help on "{address}." doesn't work. * Win32: the "Disabled" menu items would appear enabled. * No test for collapsing buffers for a channel. Some text is lost. * When writing viminfo merging current history with history in viminfo may drop recent history entries. * Some compilers can't handle a double semicolon. * Collapsing channel buffers and searching for NL does not work properly. * Warnings from 64 bit compiler. * Netbeans uses uninitialzed pointer and freed memory. * Doubled semicolons. * Tests using external command to delete directory. * Recent history lines may be lost when exiting Vim. * No test for using setqflist() on an older quickfix list. * When ":doautocmd" is used modelines are used even when no autocommands were executed. * Executing autocommands while using the signal stack has a high chance of crashing Vim. * The effect of the PopupMenu autocommand isn't directly visible. * No proper test for what 7.4.1906 fixes. * History lines read from viminfo in different encoding than when writing are not converted. * Not enough testing for parsing viminfo lines. * Register contents is not merged when writing viminfo. * Missing test changes. * vim_time() not included when needed. * Ruby 2.4.0 unifies Fixnum and Bignum into Integer. * Command line editing is not tested much. * Missing "void" for functions without argument. * Viminfo does not merge file marks properly. * Possible crash with many history items. * Compiler warning for signed/unsigned. * Overwriting pointer argument. * Inconsistent indenting and weird name. * Can't build without +spell but with +quickfix. * Using both old and new style file mark lines from viminfo. * When writing viminfo the jumplist is not merged with the one in the viminfo file. * Compiler warning about uninitialzed variable. * New style tests not executed with MinGW compiler. * When using the GUI search/replace a second match right after the replacement is skipped. * Off-by-one error in bounds check. * No test for directory stack in quickfix. * When writing viminfo numbered marks were duplicated. - Refresh vim-7.3-filetype_spec.patch- Link to perl directly instead of dlopen'ing it.- vim must require %{?libperl_requires}, if perl is not updated with vim in lockstep, the following error occurs: vim: error while loading shared libraries: libperl.so and the program stops working. (boo#982869)- Updated to revision 1883, fixes the following problems * Python: encoding error with Python 2. * Memory leaks in test49. * Invalid memory access when exiting with EXITFREE defined. * Memory leak in test_matchstrpos. * Setting really_exiting causes memory leaks to be reported. * Appending to the quickfix list while the quickfix window is open is very slow. * When a callback adds a timer the GUI doesn't use it until later. * Comparing functions and partials doesn't work well. * Typing "k" at the hit-enter prompt has no effect. * Whether a job has exited isn't detected until a character is typed. After calling exit_cb the cursor is in the wrong place. * Channel test is flaky. * Appending to a long quickfix list is slow. * Check for line break at end of line wrong. * Cppcheck found 2 incorrect printf formats.- Updated to revision 1862, fixes the following problems * Using a partial for timer_start() may cause a crash. * Compiler warnings with 64 bit compiler. * string() with repeated argument does not give a result usable by eval().- Updated to revision 1859, fixes the following problems * Tests involving Python are flaky. * Ubsan detects a multiplication overflow. * Getting an item from a NULL dict crashes. * Can't build with Strawberry Perl 5.24 (obsoletes perl-5.24.patch) * Still trying to read from channel that is going to be closed. * GUI freezes when using a job. * test_syn_attr fails when using the GUI. * Unix: Cannot run all tests with the GUI. * Crash when job and channel are in the same dict while using partials. * When setting 'termguicolors' the Ignore highlighting doesn't work. * Valgrind reports memory leak for job that is not freed. * When a channel appends to a buffer that is 'nomodifiable' there is an error but appending is done anyway. * When a channel writes to a buffer it doesn't find a buffer by the short name but re-uses it anyway. * Cannot use a function reference for "exit_cb".- Update apparmor.vim (taken from AppArmor 2.10.1) * add support for the "unspec" network keyword- Updated to revision 1842, fixes the following problems * non-antialiased misnamed. * When timer_stop() is called with a string there is no proper error message. * Memory leak in debug commands. * Cannot use an Ex command for 'keywordprg'. * Possible crash when conceal is active. * When splitting and closing a window the status height changes. * When using a partial on a dictionary it always gets bound to that dictionary. * The BufUnload event is triggered twice, when :bunload is used with `bufhidden` set to `unload` or `delete`. * Functions specifically for testing do not sort together. * Cannot get the items stored in a partial. * When using packages an "after" directory cannot be used. * The code to reallocate the buffer used for quickfix is repeated. * get() works for Partial but not for Funcref.- Fix build with perl 5.24 (perl-5.24.patch)- Updated to revision 1829, fixes the following problems * No error when invoking a callback when it's not safe. * May try to access buffer that's already freed. * No message on channel log when buffer was freed.- Updated to revision 1826, fixes the following problems * The screen is not updated if a callback is invoked when closing a channel. * Help completion adds @en to all matches except the first one. * Compiler warnings when sprintf() is a macro. * Removing language from help tags too often. * Redirecting stdout of a channel to "null" doesn't work. * When a job is no longer referenced and does not have an exit callback the process may hang around in defunc state. * When job writes to buffer nothing is written. * Callbacks are invoked when it's not safe.- Updated to revision 1816, fixes the following problems * 'guicolors' is a confusing option name. * Quickfix doesn't handle long lines well, they are split. * GTK3 doesn't handle menu separaters properly. * Can't use Vim as MANPAGER. * Running tests in shadow dir fails. * 'termguicolors' option missing from the options window. * Test_out_close_cb sometimes fails. * Using wrong feature name to check for 'termguicolors'. * Using wrong short option name for 'termguicolors'. * Sending DETACH after a channel was closed isn't useful. * Netbeans channel gets garbage collected. * Memory access error when running test_quickfix. * A channel may be garbage collected while it's still being used by a job. * Looping over a null list throws an error. - Refresh vim-7.4-filetype_mine.patch- Updated to revision 1796, fixes the following problems * Cannot use ch_read() in the close callback. * Leading white space in a job command matters. * Channel could be garbage collected too early. * Color name decoding is implemented several times. * Some character classes may differ between systems.- Updated to revision 1786, fixes the following problems * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default. * Using negative index in strcharpart(). * Warnings reported by cppcheck. * synIDattr() does not respect 'guicolors'. * strcharpart() does not work properly with some multi-byte characters. * The old regexp engine doesn't handle character classes correctly. * Compiled-in colors do not match rgb.txt.- Updated to revision 1778, fixes the following problems * When using complete() it may set 'modified' even though nothing was inserted. * When using feedkeys() in a timer the inserted characters are not used right away. * Undo options are not together in the options window. * Arguments of setqflist() are not checked properly. * No "closed", "errors" and "encoding" attribute on Python output. * Cannot use true color in the terminal. * Newly added features can escape the sandbox. * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default.- Updated to revision 1754, fixes the following problems * When a buffer gets updated while in command line mode, the screen may be messed up. * Crash when 'tagstack' is off. (Dominique Pelle) * When adding to the quickfix list the current position is reset. * "noinsert" in 'completeopt' is sometimes ignored * syntax not set when using ":buf" and 'filetype' set manually- Updated to revision 1749, fixes the following problems * Cannot detect a crash in tests when caused by garbagecollect(). * The help for functions require a space after the "(". * The Perl interface cannot use 'print' operator for writing directly in standard IO. * It is not easy to get a character out of a string. * Python: turns partial into simple funcref. * Folds may close when using autocomplete. * Test fails when not using utf-8. * It is not possible to only see part of the message history. It is not possible to clear messages. * Count for ":messages" depends on number of lines. * syn-cchar defined with matchadd() does not appear if there are no other syntax definitions which matches buffer text. * Not testing utf-8 characters. * strgetchar() does not work correctly. * Clang warns for uninitialzed variable. (Michael Jarvis) * Python: Converting a sequence may leak memory. * Memory leak in Perl. * Coverity: missing check for NULL pointer. * "gD" does not find match in first column of first line. * When using GTK 3.20 there are a few warnings.- Updated to revision 1726, fixes the following problems * Crash when calling garbagecollect() after starting a job. * When using try/catch in 'tabline' it is still considered an error and the tabline will be disabled. * Tabline test fails in GUI. * Compiler errors for non-ANSI compilers. * ANSI compiler complains about string length.- Updated to revision 1721, fixes the following problems * Leaking memory when opening a channel fails. * Coverity: not using return value of set_ref_in_item(). * Leaking memory when there is a cycle involving a job and a partial. * Tests fail without the job feature.- Updated to revision 1716, fixes the following problems * When using try/catch in 'statusline' it is still considered an error and the status line will be disabled. * For plugins in packages, plugin authors need to take care of all dependencies. * GTK GUI doesn't work on Wayland. * Non-GUI specific settings in the gvimrc_example file. * Double free when a partial is in a cycle with a list or dict. * 'autochdir' doesn't work for the first file.- Updated to revision 1710, fixes the following problems * feedkeys('i', 'x') gets stuck, waits for a character to be typed. * Building the Perl interface gives compiler warnings. * ":syn reset" clears the effect ":syn iskeyword". (James McCoy) * When using :stopinsert in a silent mapping the "INSERT" message isn't cleared. * Display problems when the 'ambiwidth' and 'emoji' options are not set properly or the terminal doesn't behave as expected. * :packadd does not work the same when used early or late. * Using freed memory when parsing 'printoptions' fails. * Using freed memory with "wincmd p". (Dominique Pelle) * Cannot use empty dictionary key, even though it can be useful. * New regexp engine does not work properly with EBCDIC. * Not all output of an external command is read.- Updated to revision 1691, fixes the following problems * When reading JSON from a channel all readahead is used. * channel_get_all() does multiple allocations. * When writing buffer lines to a pipe Vim may block. * Completion doesn't work well for a variable containing "#". * When help exists in multiple languages, adding @ab while "ab" is the default help language is unnecessary. * The Dvorak support is a bit difficult to install. * The justify plugin has to be copied or sourced to be used. * The editexisting plugin has to be copied or sourced to be used. * The swapmous plugin has to be copied or sourced to be used. * The shellmenu plugin has to be copied or sourced to be used. * A reference to the removed file_select plugin remains. * Coverity: copying value of v_lock without initializing it. * Coverity warns for not checking name length (false positive). * Coverity warns for fixed size buffer length (false positive). * Coverity: no check for NULL. * README text is slightly outdated. * There is no easy way to get all the information about a match. * When running tests $HOME/.viminfo is written. * The channel close_cb option does not work. * MzScheme does not support partial. * Ruby interface has inconsistent coding style. * Can't compile with the conceal feature but without multi-byte. * When switching to a new buffer and an autocommand applies syntax highlighting an ml_get error may occur.- Updated to revision 1665, fixes the following problems * When 'F' is in 'shortmess' the prompt for the encryption key isn't displayed. * When binding a function to a dict the reference count is wrong. * Invoking garbage collection may cause a double free. * Crash when an autocommand changes a quickfix list. * Handling emoji characters as full width has problems with backwards compatibility. * Terminating file name has side effects. * Using string() on a partial that exists in the dictionary it binds results in an error. * When a dict contains a partial it can't be redefined as a function. * Using Python vim.bindeval() on a partial doesn't work. * Using freed memory after setqflist() and ":caddbuffer". * Compiler has a problem copying a string into di_key[]. * The matchit plugin needs to be copied to be used. * Quickfix test fails. * Old style test for fnamemodify(). * Users who loaded matchit.vim manually have to change their startup. * Crash when using expand('%:S') in a buffer without a name. * remote_expr() hangs. * Crash when using partial with a timer. * On Unix in a terminal: channel messages are not handled right away. * A plugin does not know when VimEnter autocommands were already triggered. * has('patch-7.4.1') doesn't work. * No test for special characters in channel eval command. * No test for an invalid Ex command on a channel. * Crash in :cgetexpr. * Crash when calling job_start() with a NULL string.- Updated to revision 1635, fixes the following problems * Quickfix code using memory after being freed. * Using channel timeout instead of request timeout. * Timers don't work on Unix. * Not checking for failed open(). * Memory leak when out of memory. * When starting the GUI fails a swap file is left behind. * Timer with an ":echo" command messes up display. * Although emoji characters are ambiguous width, best is to treat them as full width. * Catching exception that won't be thrown. * Having type() handle a Funcref that is or isn't a partial differently causes problems for existing scripts. * Comparing a function that exists on two dicts is not backwards compatible. * string() doesn't handle a partial. * Contents file is only for Amiga distro. * Compiler warnings for non-virtual destructor. * The versplit feature makes the code uneccessary complicated. * Can't build with small features. * Still can't build with small features. * Still quickfix test in old style. * Build fails with tiny features. * Malformed channel request causes a hang. * When a JSON message is split it isn't decoded. * Starting job with output to buffer changes options in the current buffer. * When 'fileformats' is set in the vimrc it applies to new buffers but not the initial buffer. * Emoji characters are not considered as a kind of word character. * Channel test doesn't work with Python 2.6. * Channel demo doesn't work with Python 2.6. * All Channels share the message ID, it keeps getting bigger. * Can't get info about a channel. * Trying to close file descriptor that isn't open. * Missing changes to structs. * Channel out_cb and err_cb are not tested. * 64-bit Compiler warning. * Handling emoji characters as full width has problems with backwards compatibility. * Unicode table for double width is outdated. * Compiler doesn't understand switch on all enum values. * List of test targets is outdated. * If the help tags file was removed "make install" fails. * Vertical movement after CTRL-A ends up in the wrong column. * Channel test is a bit flaky.- Updated to revision 1591, fixes the following problems * Crash when using function reference. * Using ":call dict.func()" where the function is a partial does not work. * Get E923 when using function(dict.func, [], dict). * Warning for unitinialized variable. * Partial is not recognized everywhere. * Nesting partials doesn't work. * Compiler warnings with 64 bit compiler. * Old style test for quickfix. * Combining dict and args with partial doesn't always work. * Warning for shadowed variable. * The quickfix title is truncated.- Updated to revision 1579, fixes the following problems * Passing cookie to a callback is clumsy. * Dict options with a dash are more difficult to use. * Missing update to proto file. * ":helptags ALL" crashes. * An empty list in function() causes an error. * Crash when assert_equal() runs into a NULL string. * Crash in assert_fails(). * Using CTRL-] in help on option in parentheses doesn't work. * Using old style tests for quickfix. * There is no way to avoid the message when editing a file. * No test for ":help". * Setting 'compatible' in test influences following tests. * Tests get stuck at the more prompt. * ":undo 0" does not work. * Write error of viminfo file is not handled properly. * Cannot pass "dict.Myfunc" around as a partial. * There is no way to invoke a function later or periodically.- Updated to revision 1558, fixes the following problems * Using "ever" for packages is confusing. * Specifying buffer number for channel not implemented yet. * MS-Windows job_start() closes wrong handle. * Compiler warning for unitinialized variable. * MS-Windows channel leaks file descriptor. * Using feedkeys() with an empty string disregards 'x' option. * Compiler warning for shadowed variable. * The feedkeys test has a one second delay. * Cannot re-use a channel for another job. * Too many feature flags for pipes, jobs and channels. * Selection with the mouse does not work in command line mode. * Too much code in eval.c. * Channel test is a bit flaky. * Missing job_info(). * job_start() with a list is not tested. * Channel log methods are not tested. * On Win32 escaping the command does not work properly. * GTK3: horizontal cursor movement in Visual selection not good. * Sticky type checking is more annoying than useful. * Getting a cterm highlight attribute that is not set results in the string "-1". * Two tests fail. * Cannot load packages early. * Cannot generate help tags in all doc directories. * ":colorscheme" does not use 'packpath'. * ":runtime" does not use 'packpath'. * Completion for :colorscheme does not use 'packpath'. * List of test targets incomplete. * "make install" changes the help tags file, causing it to differ from the repository. * Windows cannot be identified. * It is not easy to find out what windows display a buffer.- Switch back to GTK+2 because GTK+3 interface seems to be slower.- Updated to revision 1525, fixes the following problems * Statusline highlighting is sometimes wrong. * "J" fails if there are not enough lines. * Channel output to file not implemented yet. * Channel test is a bit flaky. * Channel with disconnected in/out/err is not supported. * Channel test: Waiting for a file to appear doesn't work. * Cannot write channel err to a buffer. * On a high resolution screen the toolbar icons are too small.- Updated to revision 1510, fixes the following problems * Crash when starting a job fails. * Keeping both a variable for a job and the channel it refers to is a hassle. * Channel test fails on AppVeyor.- Updated to revision 1506, fixes the following problems * No error message when :packadd does not find anything. * Garbage collection with an open channel is not tested. * Writing last-but-one line of buffer to a channel isn't implemented yet. * Crash when using ch_getjob(). * No test for reading last-but-one line. * When channel log is enabled get too many "looking for messages" log entries. * Job cannot read from a file.- Updated to revision 1498, fixes the following problems * ":loadplugin" is not optimal, some people find it confusing. * Not using key when result from hangul_string_convert() is NULL. * "inline" is not supported by old MSVC. * Compiler warning for unused function. * Visual-block shift breaks multi-byte characters. * No command line completion for ":packadd". * Wrong callback invoked for zero-id messages. * clr_history() does not work properly. * Crash when built with GUI but it's not active. * Cursor drawing problem with GTK 3. * Error for locked item when using json_decode().- Updated to revision 1485, fixes the following problems * When using hangulinput with utf-8 a CSI character is misintepreted. * Function arguments marked as unused while they are not. * Test_reltime is flaky, it depends on timing. * ":loadplugin" doesn't take care of ftdetect files. * No test for ":loadplugin". * Cannot add a pack direcory without loading a plugin. * "timeout" option not supported on ch_eval*(). * A one-time callback is not used for a raw channel. * Channel "err-io" value "out" is not supported. * Job input from buffer is not implemented.- Updated to revision 1474, fixes the following problems * Sort test doesn't test with "1" argument. * Channel test sometimes fails, especially on OS/X. * Coverity reports missing restore. * Missing out-of-memory check. And Coverity warning. * Can't build without the autocommand feature. * Compiler warnings without the float feature.- Updated to revision 1467, fixes the following problems * Error when reading fails uses wrong errno. Keeping channel open after job stops results in test failing. * The "out-io" option for jobs is not implemented yet. * When encoding JSON, turning NaN and Infinity into null without giving an error is not useful. * JSON encoding doesn't handle surrogate pair. * Can't get buffer number of a channel. * Using empty name instead of no name for channel buffer. * Memory corruption when 'encoding' is not utf-8. * Crash when using json_decode(). * Memory leak when using ch_read(). * JSON tests fail if 'encoding' is not utf-8. * Json encoding still fails when encoding is not utf-8. * Vim hangs when a channel has a callback but isn't referenced. * Test 87 fails with Python 3.5. * Opening a channel with select() is not done properly. * When a JSON channel has a callback it may never be cleared. * When the argument of sort() is zero or empty it fails.- Updated to revision 1421, fixes the following problems * When calling ch_close() the close callback is invoked, even though the docs say it isn't. * Using "u_char" intead of "char_u", which doesn't work everywhere. * Tests slowed down because of the "not a terminal" warning. * May free a channel when a callback may need to be invoked.- Disable sniff support, its unmaintained.- Updated to revision 1410, fixes the following problems * The close-cb option is not implemented yet. * Perl eval doesn't work properly on 64-bit big-endian machine. * Having 'autochdir' set during startup and using diff mode doesn't work. * GTK 3 is not supported. * Completion menu flickers. * Leaking memory in cs_print_tags_priv(). * json_encode() does not handle NaN and inf properly. * Leaking memory in cscope interface.- Updated to revision 1397, fixes the following problems * When the Job exit callback is invoked, the job may be freed too soon. * Starting a job hangs in the GUI. * Can't sort inside a sort function.- Drop vim-7.1.314-CVE-2009-0316-debian.patch, Python 2.7 has the appropriate fix.- Updated to revision 1385, fixes the following problems * Job and channel options parsing is scattered. * Channel test ch_sendexpr() times out. * Can't remove a callback with ch_setoptions(). * Channels don't have a queue for stderr. * X11 GUI callbacks don't specify the part of the channel. * Channel read implementation is incomplete. * Calling a Vim function over a channel requires turning the arguments into a string. * ch_setoptions() cannot set all options. * Can't change job settings after it started. * The job exit callback is not implemented. * Can't get the job of a channel. * It is not easy to use a set of plugins and their dependencies.- Updated to revision 1353, fixes the following problems * Compiler warnings in build with -O2. * When there is any error Vim will use a non-zero exit code. * When the test server fails to start Vim hangs. * When the port isn't opened yet when ch_open() is called it may fail instead of waiting for the specified time. * The test script lists all functions before executing them.- Updated to revision 1345, fixes the following problems * Crash when using channel that failed to open. * Crash when closing the channel in a callback. * Channel test fails on non-darwin builds. * Channel NL mode is not supported yet. * It's difficult to add more arguments to ch_sendraw() and ch_sendexpr(). * Can't compile with +job but without +channel.- Updated to revision 1328, fixes the following problems * Cursor changes column with up motion when the matchparen plugin saves and restores the cursor position. (Martin Kunev) * "\%1l^#.*" does not match on a line starting with "#". * Channel with pipes doesn't work in GUI. * Crash when unletting the variable that holds the channel in a callback function. * Can't compile with +job but without +channel.- Updated to revision 1294, fixes the following problems * copy() and deepcopy() fail with special variables. * Encoding {'key':} to JSON doesn't give an error. * assert_false(v:false) reports an error. * When jsonencode() fails it still returns something. * jsonencode() is not producing strict JSON. * Crash when evaluating the pattern of ":catch" causes an error. * The job feature isn't available on MS-Windows. * ch_open() with a timeout doesn't work correctly. * ch_sendexpr() does not use JS encoding. - Remove vim-7.3-diff_check.patch- Updated to revision 1194, fixes the following problems * New lines in the viminfo file are dropped. * Old style tests for the argument list. * Generated function prototypes still have __ARGS(). * Wrong argument to assert_exception() causes a crash. * Illegal memory access when using :copen and :cclose. * When running gvim in the foreground some icons are missing. * Recognizing does not work when the language is Turkish. * Using searchpair() with a skip expression that uses syntax highlighting sometimes doesn't work. * Cannot define keyword characters for a syntax file. * Can't sort on floating point numbers. * Default features are conservative. * Conflict for "chartab". * Using the local value of 'errorformat' causes more problems than it solves. * 'langmap' applies to the first character typed in Select mode. * Langmap test fails with normal build. * Autocommands triggered by quickfix cannot always get the current title value. * No support for JSON. * Build with normal features fails. * Coverity warns for NULL pointer and ignoring return value. * type() does not work for v:true, v:none, etc. * Automatically generated function prototypes use __ARGS. * No error for jsondecode('"'). * ":argadd" without argument is supposed to add the current buffer name to the arglist. * Missing error number in MzScheme. * Expressions "0 + v:true" and "'' . v:true" cause an error. * No tests for "is" and "isnot" with the new variables. * This doesn't give the right result: eval(string(v:true)). * No test for new behavior of v:true et al. * The +channel feature is not in :version output. * empty() doesn't work for the new special variables. * test_writefile and test_viml do not delete the tempfile. * Crash with invalid argument to glob2regpat(). * free_tv() can't handle special variables. * Error messages for security context are hard to translate. * The channel feature isn't working yet. * Can't build with FEAT_EVAL but without FEAT_MBYTE. * Compiler warning for not using return value of fwrite().- Updated to revision 1130, fixes the following problems * Repeating CTRL-A doesn't work. * No tests for :hardcopy and related options. * When making a change while need_wait_return is set there is a two second delay. * With 'rightleft' and concealing the cursor may move to the wrong position. * Vim can create a directory but not delete it. * When using ":next" with an illegal file name no error is reported. * Using {ns} in variable name does not work. (lilydjwg) * delete() does not work well with symbolic links. * delete(x, 'rf') does not delete files starting with a dot. * No longer get "." and ".." in directory list. * argidx() has a wrong value after ":%argdelete". (Yegappan Lakshmanan) * delete(x, 'rf') fails if a directory is empty. (Lcd) * Using ":argadd" when there are no arguments results in the second argument to be the current one. (Yegappan Lakshmanan) * There is no perleval(). * Can only get the directory of the current window. * Python None value can't be converted to a Vim value. * Memory leak in :vimgrep.- Updated to revision 1087, fixes the following problems * Wrong way to check for unletting internal variables. * The Tcl interface can't be loaded dynamically on Unix. * Crash when using an invalid command. * CTRL-A does not work well in right-left mode. * Using "." to repeat CTRL-A in Visual mode increments the wrong numbers. * The CTRL-A and CTRL-X commands do not update the '[ and '] marks. * Crash with an extremely long buffer name. * CTRL-A and CTRL-X work badly with blockwise visual selection- Updated to revision 1066, fixes the following problems * Segfault when unletting "count". * Illegal memory access with weird syntax command. (Dominique Pelle) * Typos in the :options window. * Compiler warning for ignoring return value of fwrite(). * When a spell file has single letter compounding creating suggestions takes an awful long time.- Updated to revision 1046, fixes the following problems * The fix in patch 7.3.192 is not tested. * When a symbolic link points to a file in the root directory, the swapfile is not correct. * Vim overwrites the value of $PYTHONHOME. * The local value of 'errorformat' is not used for ":lexpr" and ":cexpr". * The column is not restored properly when the matchparen plugin is used in Insert mode and the cursor is after the end of the line. * When there is a backslash in an option ":set -=" doesn't work. * An Ex range gets adjusted for folded lines even when the range is not using line numbers. * Using "q!" when there is a modified hidden buffer does not unload the current buffer, resulting in the need to abandon it again. * g-CTRL-G shows the word count, but there is no way to get the word count in a script.- Updated to revision 1004, fixes the following problems * searchpos() always starts searching in the first column, which is not what some people expect. (Brett Stahlman) * Leaking memory when hash_add() fails. Coverity error 99126.- Updated to revision 979, fixes the following problems * When pasting on the command line line breaks result in literal characters. This makes pasting a long file name difficult. * When using :diffsplit the cursor jumps to the first line. * Using ":sort" on a very big file sometimes causes text to be corrupted. (John Beckett) * test_cdo fails when using another language than English. * When changing the crypt key the blocks read from disk are not decrypted.- Updated to revision 972, fixes the following problems * Test 87 doesn't work in a shadow directory. * Configure doesn't work with a space in a path. * test86 and test87 are flaky in Appveyor. * Rare crash in getvcol(). (Timo Mihaljov) * The asin() function can't be used. * Memory leak when there is an error in setting an option.- Updated to revision 963, fixes the following problems * Crash when dragging with the mouse. * Segfault reading unitialized memory. * X11 and GTK have moure mouse buttons than Vim supports. * Memory leak when encountering a syntax error. * vt52 terminal codes are not correct. * There is no way to ignore case only for tag searches. * test_tagcase breaks for small builds. * Writing tests for Vim script is hard. * New style testing is incomplete. * Missing changes in source file. * Test_listchars fails with MingW. (Michael Soyka) * Can't build when the insert_expand feature is disabled. * When using 'colorcolumn' and there is a sign with a fullwidth character the highlighting is wrong. (Andrew Stewart) * v:errors is not initialized. * Sorting number strings does not work as expected. (Luc Hermitte) * 'lispwords' is tested in the old way. * When a test script navigates to another buffer the .res file is created with the wrong name. * When using Lua there may be a crash. (issue #468) * Vim doesn't recognize .pl6 and .pod6 files. * A few more file name extensions not recognized. * Test_tagcase fails when using another language than English. * Vim checks if the directory "$TMPDIR" exists. * When setting 'term' the clipboard ownership is lost. * Test107 fails in some circunstances. * Cannot run the tests with gvim. Cannot run individual new stests. * test_listlbr_utf8 sometimes fails.- Updated to revision 935, fixes the following problems * Test 94 fails on some systems. * test_utf8 has confusing dummy command. * Crash when using longest completion match.- Updated to revision 930, fixes the following problems * When a BufLeave autocommand changes folding in a way it syncs undo, undo can be corrupted. * Python interface can produce error "vim.message' object has no attribute 'isatty'". * Libraries for dynamically loading interfaces can only be defined at compile time. * Compiler complains about type punned pointer. * t_Ce and t_Cs are documented but not supported. (Hirohito Higashi) * Wrong indenting for C++ constructor. * No utf-8 support for the hangul input feature. * New compiler warning: logical-not-parentheses * When removing from 'path' and then adding, a comma may go missing. (Malcolm Rowe) * When running out of memory while copying a dict memory may be freed twice. (ZyX) * Compiler warning for comparing signed and unsigned. * A digit in an option name has problems. * The dll options are not in the options window. * The rubydll option is not in the options window. * Missing proto file update. (Randall W. Morris) * Leaking memory with ":helpt {dir-not-exists}". * Prototypes not always generated. * User may yank or put using the register being recorded in. * Completing the longest match doesn't work properly with multi-byte characters. * Ruby crashes when there is a runtime error. * A clientserver message interrupts handling keys of a mapping. * "gv" after paste selects one character less if 'selection' is "exclusive". * MS-Windows: Most users appear not to like the window border. - Refresh vim-7.3-sh_is_bash.patch- Updated to revision 898, fixes the following problems * Build failure when using dynamic python but not python3. * Indentation of array initializer is wrong. * On MS-Windows the iconv DLL may have a different name. * C indenting is wrong below a "case (foo):" * vimrun.exe is picky about the number of spaces before -s. * Custom command line completion does not work for a command containing digits. * Editing a URL, which netrw should handle, doesn't work. * Freeze and crash when there is a sleep in a remote command. (Karl Yngve Lervåg) * The 'fixendofline' option is set on with ":edit".- Updated to revision 889, fixes the following problems * Crash when changing the 'tags' option from a remote command. (Benjamin Fritz) * 'smarttab' is also effective when 'paste' is enabled. (Alexander Monakov) * May get into an invalid state when using getchar() in an expression mapping. * Vim leaks memory, when 'wildignore' filters out all matches. * Compiler warning for unused variable. (Tony Mechelynck) * Not obvious how to contribute. * ":find" sometimes fails. (Excanoe) * Coverity error for clearing only one byte of struct. * Can't see line numbers in nested function calls. * Test 49 fails. * When leaving the command line window with CTRL-C while a completion menu is displayed the menu isn't removed. * Block-mode replace works characterwise instead of blockwise after column 147. (Issue #422) * When doing an upwards search without wildcards the search fails if the initial directory doesn't exist. * Using uninitialized memory for regexp with back reference. (Dominique Pelle) * The OptionSet autocommands are not triggered from setwinvar(). * Triggering OptionSet from setwinvar() isn't tested.- Updated apparmor.vim (taken from AppArmor 2.10.0) * add support for the "ib" and "mpls" network keywords- Updated to revision 865, fixes the following problems * GTK: font glitches for combining characters * "zt" still doesn't work well with filler lines. (Gary Johnson) * Dragging the current tab with the mouse doesn't work properly. * It's a bit clumsy to execute a command on a list of matches. * Vim doesn't recognize all htmldjango files. * Filetype detection is outdated. * pango_shape_full() is not always available. * Still problems with pango_shape_full() not available. * plines_nofill() used without the diff feature.- Updated to revision 854, fixes the following problems * When '#' is in 'isident' the is# comparator doesn't work. * Compiler warning for possible loss of data. * "vi)d" may leave a character behind. * CTRL-A on hex number in Visual block mode is incorrect. * Moving the cursor in Insert mode starts new undo sequence. * does not show up. * Saving and restoring the console buffer does not work properly. * "zt" in diff mode does not always work properly. (Gary Johnson) * Missing information about runtime files.- Updated to revision 843, fixes the following problems * Xxd doesn't have a license notice. * The ruler shows "Bot" even when there are only filler lines missing. (Gary Johnson) * CTRL-A in Visual mode doesn't work properly with "alpha" in 'nrformat'. * After CTRL-V CTRL-A mode isn't updated. (Hirohito Higashi) * With a sequence of commands using buffers in diff mode E749 is given. (itchyny) * Invalid memory access when using "exe 'sc'". * Gcc sanitizer complains about using a NULL pointer to memmove(). * It is not possible to save and restore character search state. * Illegal memory access with "sy match a fold". * Invalid memory access when doing ":call g:". * Invalid memory access when doing ":fun X(". * Invalid memory access in file_pat_to_reg_pat(). * 'linebreak' breaks c% if the last Visual selection was block. (Chris Morganiser, Issue 389) * Invalid memory access in file_pat_to_reg_pat. * Cursor moves after CTRL-A on alphabetic character. * Invalid memory access for ":syn keyword x a[". * Crash when using "syn keyword x c". (Dominique Pelle) * Crash when clicking in beval balloon. (Travis Lebsock) * Resetting 'encoding' when doing ":set all&" causes problems. (Bjorn Linse) Display is not updated. * When expanding `=expr` on the command line and encountering an error, the command is executed anyway. * $HOME in `=$HOME . '/.vimrc'` is expanded too early. * More side effects of ":set all&" are missing. (Björn Linse) * gettabvar() doesn't work after Vim start. (Szymon Wrozynski) * Comparing utf-8 sequences does not handle different byte sizes correctly. * Can't compile without the crypt feature. (John Marriott) - Refresh vim-7.3-diff_check.patch- Updated to revision 803, fixes the following problems * Repeating a change in Visual mode does not work as expected. (Urtica Dioica) * Accessing memory before an allocated block. * Using freed memory when triggering CmdUndefined autocommands. * Test for ":diffoff" doesn't catch all potential problems. * Using "A" in Visual mode while 'linebreak' is set is not tested. * C indent does not support C11 raw strings. (Mark Lodato)- Updated to revision 797, fixes the following problems * Using freed memory and crash. (Dominique Pellej) * Test fails when the autochdir feature is not available. Test output contains the test script. * The buffer list can be very long. * Can only conceal text by defining syntax items. * Can't specify when not to ring the bell. * The 'fixeol' option is not copied to a new window. * Warning from 64 bit compiler. * Crash when using more lines for the command line than 'maxcombine'.- Updated to revision 788, fixes the following problems * CTRL-A and CTRL-X in Visual mode do not always work well. * :diffoff only works properly once. * Behavior of :diffoff is not tested. * Background color response with transparency is not ignored. * Search does not handle multi-byte character at the start position correctly. * 'langmap' is used in command-line mode when checking for mappings. Issue 376. * When using the CompleteDone autocommand event it's difficult to get to the completed items. * It is not possible to avoid using the first item of completion. * Equivalence class for 'd' does not work correctly. * Coverity warns for uninitialized variable. * Using CTRL-A in a line without a number moves the cursor. May cause a crash when at the start of the line. (Urtica Dioica) * Compiler complains about uninitialized variable and clobbered variables. * line2byte() returns one less when 'bin' and 'noeol' are set. * Still a few problems with CTRL-A and CTRL-X in Visual mode. * copy_chars() and copy_spaces() are inefficient. * Using both "noinsert" and "noselect" in 'completeopt' does not work properly. * On some systems automatically adding the missing EOL causes problems. Setting 'binary' has too many side effects. * It is not possible for a plugin to adjust to a changed setting. * snprintf() isn't available everywhere.- Updated to revision 763, fixes the following problems * Appending in Visual mode with 'linebreak' set does not work properly. Also when 'selection' is "exclusive". (Ingo Karkat) * Using CTRL-A in Visual mode does not work well. (Gary Johnson) * It is not easy to count the number of characters. * Cannot detect the background color of a terminal. * When 'conceallevel' is 1 and quitting the command-line window with CTRL-C the first character ':' is erased. * Spelling mistakes are not displayed after ":syn spell". * The request-background termcode implementation is incomplete. * Comment for may_req_bg_color() is wrong. (Christ van Willegen)- Updated to revision 752, fixes the following problems * When setting the crypt key and using a swap file, text may be encrypted twice or unencrypted text remains in the swap file. * The tab menu shows "Close tab" even when it doesn't work. * The cursor line is not always updated for the "O" command. * ml_get error when using "p" in a Visual selection in the last line. * Wrong argument for sizeof(). * In a string "\U" only takes 4 digits, while after CTRL-V U eight digits can be used. * ":1quit" works like ":.quit". (Bohr Shaw) * When using += with ":set" a trailing comma is not recognized. (Issue 365) * Cannot specify a vertical split when loading a buffer for a quickfix command. * "p" in Visual mode causes an unexpected line split. * No tests for Ruby and Perl. * The entries added by matchaddpos() are returned by getmatches() but can't be set with setmatches(). (Lcd) * ":[count]tag" is not always working. (cs86661) * ":cnext" may jump to the wrong column when setting 'virtualedit=all' * For some options two consecutive commas are OK. (Nikolay Pavlov) * It is not obvious how to enable the address sanitizer. * Unicode 8.0 not supported.- Make Perl support dynamic bsc#804070- Updated to revision 729, fixes the following problems * Illegal memory access when there are illegal bytes. * ":let list += list" can change a locked list. * Autocommands triggered by quickfix cannot get the current title value. * Overflow when adding MAXCOL to a pointer. * When 'list' is set Visual mode does not highlight anything in empty lines. (mgaleski) * 0x202f is not recognized as a non-breaking space character. * For indenting, finding the C++ baseclass can be slow. * ":call setreg('"', [])" reports an internal error. * Occasional crash with 'list' set.- Updated to revision 712, fixes the following problems * Out-of-bounds read, dectected by Coverity. * Not freeing memory when encountering an error. * The filename used for ":profile" must be given literally. * Various problems with locked and fixed lists and dictionaries. * E315 when trying to delete a fold. (Yutao Yuan) * Fold can't be opened after ":move". (Ein Brown) * Compiler warning for using uninitialized variable. (Yasuhiro Matsumoto) * Joining an empty list does uneccessary work. * Compiler warning for start_dir unused when building unittests. * Searching for a character matches an illegal byte and causes invalid memory access. (Dominique Pelle) * Can't build with Ruby 2.2. * Window drawn wrong when 'laststatus' is zero and there is a command-line window. (Yclept Nemo) * Undo files can have their executable bit set. * gettext() is called too often. * ":tabmove" does not work as documented. * It is not possible to make spaces visibible in list mode.- Updated to revision 694, fixes the following problems * When starting several Vim instances in diff mode, the temp files used may not be unique. (Issue 353) * When there are illegal utf-8 characters the old regexp engine may go past the end of a string. * "zr" and "zm" do not take a count. * There is no way to use a different in Replace mode for a terminal. * When "$" is in 'cpo' the popup menu isn't undrawn correctly. (Issue 166) * Memory access errors when changing indent in Ex mode. Also missing redraw when using CTRL-U. (Knil Ino) * Can't build with MzScheme. * Session file is not correct when there are multiple tab pages. * Running tests changes the .viminfo file.- Updated to revision 683, fixes the following problems * When using --remote the directory may end up being wrong. * CTRL-W in Insert mode does not work well for multi-byte characters. * MS-Windows: When Vim is minimized the window height is computed incorrectly. * The search highlighting and match highlighting replaces the cursorline highlighting, this doesn't look good. * Typo in the vimtutor command.- Updated to revision 676, fixes the following problems * When 'ruler' is set the preferred column is reset. (Issue 339) * Using freed memory when g:colors_name is changed in the colors script. (oni-link) * Using "0 CTRL-D" in Insert mode may have CursorHoldI interfere. (Gary Johnson) * When 'M' is in the 'cpo' option then selecting a text object in parenthesis does not work correctly. * When using netbeans a buffer is not found in another tab. * When 'compatible' is reset 'numberwidth' is set to 4, but the effect doesn't show until a change is made. * 'linebreak' does not work properly with multi-byte characters. * There is a chance that Vim may lock up. * 'colorcolumn' isn't drawn in a closed fold while 'cursorcolumn' is. (Carlos Pita) * Can't use a glob pattern as a regexp pattern. * When netbeans is active the sign column always shows up. * Using 'cindent' for Javascript is less than perfect. * Warning for shadowing a variable. * When completing a shell command, directories in the current directory are not listed. * The first syntax entry gets sequence number zero, which doesn't work. (Clinton McKay) * Missing changes in one file. * When a FileReadPost autocommand moves the cursor inside a line it gets moved back. - Refresh vim73-no-static-libpython.patch- Updated to revision 658, fixes the following problems * The tabline menu was using ":999tabnew" which is now invalid. * When using "gf" escaped spaces are not handled. * Stratus VOS doesn't have sync(). * When splitting the window in a BufAdd autocommand while still in the first, empty buffer the window count is wrong. * ":bufdo" may start at a deleted buffer. * Compiler complains about ignoring return value of fwrite(). (Michael Jarvis) * Configure check may fail because the dl library is not used. * Can't match "%>80v" properly for multi-byte characters. * Xxd lacks a few features. * Insert mode completion with complete() may have CTRL-L work like CTRL-P. * glob() and globpath() cannot include links to non-existing files. (Charles Campbell) * Text deleted by "dit" depends on indent of closing tag. (Jan Parthey) * Missing changes for glob() in one file. * Compiler warnings for pointer mismatch. * 'formatexpr' is evaluated too often.- Updated to revision 640, fixes the following problems * When using Insert mode completion combined with autocommands the redo command may not work. * The default conceal character is documented to be a space but it's initially a dash. (Christian Brabandt) * 7.4.592 breaks the netrw plugin, because the autocommands are skipped. * Marks are not restored after redo + undo. * If no NL or CR is found in the first block of a file then the 'fileformat' may be set to "mac". (Issue 77) * A search with end offset gets stuck at end of file. (Gary Johnson) * Incorrectly read the number of buffer for which an autocommand should be registered. * Can't build with Lua 5.3 on Windows. * Combination of linebreak and conceal doesn't work well. * After deleting characters in Insert mode such that lines are joined undo does not work properly. (issue 324)- Updated to revision 629, fixes the following problems * For complicated list and dict use the garbage collector can run out of stack space. * Syntax error. * The NFA engine does not implement the 'redrawtime' time limit. * Vim hangs when freeing a lot of objects. * Wrong ":argdo" range does not cause an error. * luaV_setref() is missing a return statement. (Ozaki Kiichi) * luaV_setref() not returning the correct value. * Compiler warning for unitinialized variable. (Tony Mechelynck) * Returning 1 in the wrong function. (Raymond Ko) * Compiler warning for unused argument. * Crash with pattern: \(\)\{80000} (Dominique Pelle) * May leak memory or crash when vim_realloc() returns NULL. * Possible NULL pointer dereference. * The last screen cell is not updated. * Compiler warning for variable might be clobbered by longjmp. * Coverity warning for Out-of-bounds read. - Remove vim-speedup-gc.patch, fixed upstream- Updated to revision 608, fixes the following problems * Compiler warnings for unitinialized variables. (John Little) * Can't match "%>80v" properly. (Axel Bender) * Range for :bdelete does not work. (Ronald Schild) * Parallel building of the documentation html files is not reliable. * Conceal does not work properly with 'linebreak'. (cs86661) * ":0argedit foo" puts the new argument in the second place instead of the first. * Using ctrl_x_mode as if it contains flags. * test_listlbr_utf8 fails when the conceal feature is not available. * When doing ":e foobar" when already editing "foobar" and 'buftype' is "nofile" the buffer is cleared. (Xavier de Gaye) * Crash when searching for "x\{0,90000}". (Dominique Pelle) * Using a block delete while 'breakindent' is set does not work properly. * The test_command_count test fails when using Japanese. * Tiny build doesn't compile. (Ike Devolder) * Cannot change the result of systemlist(). * Out-of-memory error. * Memory wasted in struct because of aligning. * It is not possible to have feedkeys() insert characters. * ":set" does not accept hex numbers as documented. * 'foldcolumn' may be set such that it fills the whole window, not leaving space for text. * Running tests changes viminfo. * The # register is not writable, it cannot be restored after jumping around. * May crash when using a small window. * Compiler warnings for unused variables.- Add vim-speedup-gc.patch to improve garbage collection performance. Based on https://github.com/neovim/neovim/pull/1761 (boo#899747)- Modify vim-7.3-filetype_changes.patch to expand tabs when editing * .changes files (bnc#900839)- Update suse.vimrc to stop remembering file positions for git commit cases. This fixes bnc#538369 and based on msys commits 1ef258e and 65ffc90.- Updated to revision 580, fixes the following problems * Ex range handling is wrong for buffer-local user commands. * Segfault with wide screen and error in 'rulerformat'. (Ingo Karkat) * No test for replacing on a tab in Virtual replace mode. * FEAT_OSFILETYPE is used even though it's never defined. * Ranges for arguments, buffers, tabs, etc. are not checked to be valid but limited to the maximum. This can cause the wrong thing to happen. * :argdo, :bufdo, :windo and :tabdo don't take a range. * Non-ascii vertical separater characters are always redrawn. * Giving an error for ":0wincmd w" is a problem for some plugins. * Having CTRL-C interrupt or not does not check the mode of the mapping. (Ingo Karkat) * Building with dynamic library does not work for Ruby 2.2.0 * Can't build with tiny features. (Ike Devolder) * Address type of :wincmd depends on the argument. * Mapping CTRL-C in Visual mode doesn't work. (Ingo Karkat) * No error for eval('$'). * Unicode character properties are outdated. * Redrawing problem with 'relativenumber' and 'linebreak'. * Matching with a virtual column has a lot of overhead on very long lines. (Issue 310) * Using getcurpos() after "$" in an empty line returns a negative number. * Wrong cursor positioning when 'linebreak' is set and lines wrap. * ":52wincmd v" still gives an invalid range error. (Charles Campbell)- Updated to revision 560, fixes the following problems * Tests fail with small features plus Python. * Crash when computing buffer count. Problem with range for user commands. Line range wrong in Visual area. * Cannot build with tiny and small features. (Taro Muraoka) * Crash when doing a range assign. * Using a range for window and buffer commands has a few problems. Cannot specify the type of range for a user command. * Since patch 7.4.232 "1,3s/\n//" joins two lines instead of three. (Eliseo Martínez) Issue 287 * Warnings for unused arguments when compiling with a combination of features. * Highlighting for multi-line matches is not correct. * Repeated use of vim_snprintf() with a number. * Using "vit" does not select a multi-byte character at the end correctly. * Function name not recognized correctly when inside a function. * curs_rows() function is always called with the second argument false. * "ygn" may yank too much. (Fritzophrenic) Issue 295. * Langmap applies to Insert mode expression mappings. * Various small issues. * Missing part of patch 7.4.519. * test_close_count may fail for some combination of features. * Failed commands in Python interface not handled correctly. * One more small issue. * When the X server restarts Vim may get stuck. * Appending a block in the middle of a tab does not work correctly when virtualedit is set. * Memory leak using :wviminfo. Issue 296.- use SUSE LINUX GmbH everywhere- Updated to revision 537, fixes the following problems * With a wrapping line the cursor may not end up in the right place. (Nazri Ramliy) * Using status line height in width computations. * Crash when using syntax highlighting. * Sun PCK locale is not recognzed. * When using "vep" a mark is moved to the next line. (Maxi Padulo, Issue 283) * Specifying wrong buffer size for GetLongPathName(). * When the X11 server is stopped and restarted, while Vim is kept in the background, copy/paste no longer works. (Issue 203) * When using ":ownsyntax" spell checking is messed up. (Issue 78) * map() leaks memory when there is an error in the expression. * matchstr() fails on long text. Daniel Hahler) * Still confusing regexp failure and NFA_TOO_EXPENSIVE. * Crash when using matchadd() (Yasuhiro Matsumoto) * No test for what 7.4.517 fixes. * Many commands take a count or range that is not using line numbers. * Comments about parsing an Ex command are wrong. * When using 'incsearch' "2/pattern/e" highlights the first match. * ":hardcopy" leaks memory in case of errors. * Warnings when compiling if_ruby.c. * Can't build with tiny features. * Test 63 fails when using a black&white terminal. * Value of v:hlsearch reflects an internal variable.- Updated to revision 516, fixes the following problems * When generating ja.sjis.po the header is not correctly adjusted. * Users are not aware their encryption is weak. * "-fwrapv" argument breaks use of cproto. * Generating proto for if_ruby.c uses type not defined elsewhere. * Crash because reference count is wrong for list returned by getreg(). * Memory access error. (Dominique Pelle) * In a help buffer the global 'foldmethod' is used. (Paul Marshall) * Completing a function name containing a # does not work. Issue 253.- Updated to revision 507, fixes the following problems * Setting the local value of 'backupcopy' empty gives an error. (Peter Mattern) * Compiler warning. * Crash when expanding a very long string. * CTRL-W } does not open preview window. (Erik Falor) * 'linebreak' does not work well together with Visual mode. * Issue 26: CTRL-C does not interrupt after it was mapped and then unmapped. * The "precedes" entry in 'listchar' will be drawn when 'showbreak is set and list is not. * Cursor movement is incorrect when there is a number column/sign/fold column and 'sbr' is displayed. * Can't compile on a system where Xutf8SetWMProperties() is not in the X11 library. Issue 265. * When using ":%diffput" and the other file is empty an extra empty line remains. * Using byte length instead of character length for 'showbreak'. * When 'balloonexpr' results in a list, the text has a trailing newline. (Lcd) * A 0x80 byte is not handled correctly in abbreviations. * Abbreviations don't work. (Toothpik) * Check for writing to a yank register is wrong. * ":sign jump" may use another window even though the file is already edited in the current window. * test_mapping fails for some people. * Cursor movement still wrong when 'lbr' is set and there is a number column. (Hirohito Higashi) * Cannot specify the buffer to use for "do" and "dp", making them useless for three-way diff. * When winrestview() has a negative "topline" value there are display errors. * In Insert mode, after inserting a newline that inserts a comment leader, CTRL-O moves to the right. (ZyX) Issue 57. * A TextChanged autocommand is triggered when saving a file. (William Gardner) * Cursor shape is wrong after a CompleteDone autocommand. * XPM isn't used correctly in the Cygwin Makefile. * With some regexp patterns the NFA engine uses many states and becomes very slow. To the user it looks like Vim freezes. * substitute() can be slow with long strings. * Test 72 still fails once in a while. * Typo in file pattern. * Language mapping also applies to mapped characters. * Cannot append a list of lines to a file.- Updated apparmor.vim (taken from AppArmor 2.9.0) * add support for 'hat' keyword * fix highlighting of comments in alias and link rules/bin/sh/bin/shgvim-basegvim-enhancedsheep21 1671443296 9.0.1040-150000.5.31.19.0.1040-150000.5.31.19.0.1040-150000.5.31.19.0.1040-150000.5.31.19.0.1040-150000.5.31.19.0.1040-150000.5.31.19.0.1040-150000.5.31.1 vivimgvimrcegviewegvimeviewevimgexgvigviewgvimgvimdiffrgviewrgvimvivimgvim.desktopgvimREADME.Japanese-XIMgui_x11.txtgvimrc_example.vimsuse.gvimrcgvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.svg/etc/alternatives//etc//usr/bin//usr/share/applications//usr/share/doc/packages//usr/share/doc/packages/gvim//usr/share/icons/hicolor/24x24/apps//usr/share/icons/hicolor/32x32/apps//usr/share/icons/hicolor/48x48/apps//usr/share/icons/hicolor/64x64/apps//usr/share/icons/hicolor/96x96/apps//usr/share/icons/hicolor/scalable/apps/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:27247/SUSE_SLE-15_Update/1d8bbe09b502e3e6b9711a0f720dd0b3-vim.SUSE_SLE-15_Updatedrpmxz5x86_64-suse-linux cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.0.1040-150000.5.31.1.x86_64/etc/alternatives/vi' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.0.1040-150000.5.31.1.x86_64/etc/alternatives/vim' (No such file or directory)ASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=82738702bf82cdc78d238bee700c2924611650ca, for GNU/Linux 3.2.0, strippeddirectoryPNG image data, 24 x 24, 8-bit/color RGBA, non-interlacedPNG image data, 32 x 32, 8-bit/color RGBA, non-interlacedPNG image data, 48 x 48, 8-bit/color RGBA, non-interlacedPNG image data, 64 x 64, 8-bit/color RGBA, non-interlacedPNG image data, 96 x 96, 8-bit/color RGBA, non-interlacedSVG Scalable Vector Graphics image$$R%RR R'RR#R RRR RR RRRRR RRRRRRRRRRRR&R$RRRR!R"R PPP P PP PPPPPPPPPP P Ϭ . `<$utf-8f008c843cf283e2ffecdf2020904671da94f4752835d1a288383582f4bc72185?7zXZ !t/! ]"k%{J #(\p2g@V.Pk75`5;Y]#v l n&UkҖp1a{~n&U&|#Թ'CC%}8xIނ~ 2Z_n6mm;7UP`Zev%SIJL4o-"un ZA#*,aK L|OǓMZ3`aL!cگHh :pJ6}P}û.NNi< 4^!)c= {l玦#xQKr_tcvRlC:{\J08E@ zM UI%iʳY|`cx8(T̿B-5b:KTloxhѧmVgv !ۭ9Ԣgjzt~g޵ƱnZNkܬn{ɪíI#(\N 1#IsN!U9oW<@ml'E\UV7o"}m$%z.3CīƜk'q9tY#fi8s' n֛?(эΖz /Y\s#e.ONfJ`Z\=r - z%tfGwʠRC_rFv$6mnU)p{mI=_UnWy,Ԥ r\%<5ތrJvҳҾ?vUVTaerK4h9b6tJi'|Z J@,.K PB [ 'ͷu+#15Ю@;oJ~ְ[yKnQL8 eB"ߒwYC'w ɡt-|zp=IUg=44sF(D UXqZm3dih31FIalhZpfU,db﨨;`laU`]o{`9"6_9 < 27f 6sqkrf"$y90\X#oxYz7[]OO Վmsv~|ÌCC뷽nP^UŤ"a1aIR\7K{5a{ [RJfoBRqwvи2vN+4e1| ӟc(\y4.ܯדI1E5c~}TG D\t_C;UXVUO`f6jB Dz-[}ŠYA~.WM.S=]O>M%Ed/%o)9]A +pr پ% PJE2Q7O(3;k,^)L}mF\uz'=$LĞK'E ,~5kT&sO%EŪg8S4 4T#}IbbN Z'H,(/%) R|2Ѓ$9]h܍kQY܈$L.e)sxs3t/(4KPP5ttV?)׮`fD3#񫵺4a +^\}?m) PDTw8b`\# CuB]E3o˯?/ pYL ٙ 3Gua9Iw='f$z0$%GϬTuK˔Q{z+m$j8SsՔ!j3)r?dӢZ1pr(p ׳"^:;Vn2T+:3ĺsbީ&͟( t+ KVl0(,[apcĖNe]{{$mxÂF+HKwګ=;&;nc!4:$U v)[aɲ>w"Jrp4{dRd7 3 OaOgXKVKICG|jH?8J_\қy9mnLJ`cXSh{KQZ]8{;btbٞKbV ݹ.!9eɾNbG [#8)ev4r6 ?;[)~دTaYIT<޺o:T`4˜0?S|T("~? X٤-/fi kK,jyXS >> `Z.+oX ;iSSp@n;Bf,A rYfO]|)P&oȺP:jLxl:33ВE˧FX~%Ղi2eQ IJg>KɟՊOzZԚyQxƜfk~jc/hH w DI'`S%Z (26Uaho,=@.a|E}6;` ZIٰ8Mo,8cZsu4 ][T@v]F2 #T%K~/ u!o>K|_w>́b5,M*d\ BT^ b@Z5O*xEW-MTo޶R-& y6}!nXspK k"FH龑ݺu!bG,@[ =B.>j肸|0}c'Bk#*+ S2i K88-iVEN(-l*4'6mq|F߫NLBޢk(bIьEZ J*梏YS7n QؐL 9# {?MU+j@Oi*C r1HCm.yawdW~闀9Mޡ. 9Nφʃ߻tON e5(qQxK( JZב n6j 8W[jW);&>1iԢ 1q!E$ޡWN&Vʝ 앥ue,.ak\1ֶ0D;s}[#7b2a Q-B(gL on'%7`ƈN47N[o}-F5@D׈nP4111 R`DņU?Oad#W02i׌,2"q+3|ymE~1@,sI,dG*^/W${!(0!hlHz,5"N~ÈamwhIQ;Bd=IARR9PdߪsW0{< g0ܢjhrNyHX@C)Cn ګQw@SXg_cP)߮xVeĀ\|,"W<TKr`j#oȷÿZgB%Bc^NUσ׋Wmz_Ȕ|~uIN !b!Cp`570 )~g_!_CkTإ!g'`DPye ktwy %?w ~V~ }}H3_f>5 );Nmu;z9y)a,n(Nkz)|C24R3 n7˺> p6Qte~;gUbpR T?qAF&8_O爿zLGY/$ɓyJPaA$s?^m~n2כQ!yTfD9.nE'̚Y38?kKnG{A:jq}DƎy:_ς(ᮕ7:92Ӽ=]H:2Bf5 =eHͽJ_VeQ̰@J&6|wA!2dr #91S:U IltU{Guw=G~l-+Vk?WrO}PyJ³$TyEڴ*ؐ xVcg!N7(J[cJUżx|8+Oi̾ 2MvᶸǣȫVȡpS_~^Pki^=4(.fbEi9B~hHbX0&T#^ GdZJک/ueOj| ,P&D*-}鑋W#)`זongVS,[h>#_lֈy($J|%ܽ#w3د&Vtlj/$t^j6LVgN3 IǑտHQOd|q)fN?~Zȃֺێjl"?y|MMpOk F->1"?]7;D6c1{p ;GǠǤ׵W;1sL3F[F焓ɂjpK5ՂDGz-AJ"oiҵL]@*%"t&'$$3/`:ai;/ui=gp%@xԺd $vS,͟ dB&-7 tLRSoź]5VʽseډT/c1ƥԂ!`l|l|nĮľqˋQߝ ȓ[P#/K sLzZHJ1 l7k0ę@*Tuo ډ03=ю*|Tv{̒JtoWLpl6ȼM-F%*|S{%tL.3fN$=]m?MSC{EOբcfeƟ]TX¡ҁBkmUo" zZDg?, ;i?set&nt)hW,bFlOi?<.XU~KB)6AutΖ!"iMYw̑+3BCd B\T Эsߌ\ +P&H_4p+I'{QMro *gNF'^M)=+Y/1V5Wvš4>+软o”@oZ:{sԽE `$5StxU{'($s)x^*+Tb쵣੷=w4捍=* jlq2B[q=;Fp=@QgNKP9 ~a W9&HGKDU1쬱whj]7]}LZ`@9"%1vkOQDuLNBQ"6_xNk.6 cMg<,\ _y*[QlM˯Yϑ=څqaIk(xg ݡU{@,or> ˯ҪI%+'nju A{"fqIp :̱ -^,jVMʶXi**HC ?4^%AE0BT=(9}benKgi39dl̟e|?v0NiVt1n1Qd$!3 -eٞQ ZlNgѹ9FU\e)Ed(r [j&7\JY0[S&Q@%EMz.BQE$kNCy;edgԏj]7ufEqkr:ҲCCT;H\8Sv\ TzK22?Xߟ;6?Ym0bǸWJ&:ԭ`-Edq폋xBYVnh, ֚Q1~zKzD&銶/"s5p%OW<骴S C 6j'sm7lip<:zh(_XИLkyjzFֶPPg3| i4|E~Lؘw8V WG]qR2"Obo:mzT,//@f^OŮxL\ZcFMvv;k)Q= )9l%GCR /vj/-13>sfulsE:[J֑-k~ƚNo?pSBk4_;`!+7xSd|M8aT+>HK#uY Kb,9l86Aտ5׆䰔M/yҰa,Y$a!տVhPyE]qhڕ'Z+7ca*P~Y0Mm4r^oy+Mgc/#^ݯ[Dk:_SBJSwe¡?JKpMtH¸c? wIJ^pr-6쾝VdC\uFS^0AhyM$XA&YUҎM1h ߈Q/a-$#ؑrSzH+ yxѾjQHEöta^or g%El1?Li#4jIV  fk Y)w3X mb=/vcxa0&؂ӥ;8o!Q3`L B|R;RvWKĨN{؂JOi-dFNq!eRϬwE<xIwUIk]=&;59^AT֬1m2ibaBe_#ߨ^Ąk )NżP5=hV8,FZ8jp b\s&ڹA,> ×CViɌ/JhZx&t*R"6ZCLI%25'nssg3kۨ[%USL`v&˩l8 ,Ol"nz[pxa9"g y \~B.>nvd>f[:Mt2>-" LmM#եM>"xL pNzNBH6b# )aCC*d+~p4LAhp.xx6XNi^mk3 /.4IîEqsgQcK<ɨPB9s$kMfЄ ataͪ%jxǪVnhgE25v,ߩ)jgcΝYV: 9>rTuh67;* muh1(͝P_|)6JMTlNLmW-@( Rg*0G\D=\Uc*fҕߴRrfJP-a; xo[ ~Է^U.%mdV)}<}Ң:LgtgU):ǝg~&FBnbInqFuyL/{s*2עNc ^6 8 xV]L|J22̢ zLedܥO0:P#OۧɩoyWHJ3 hlC6j %:z) s]ܱ!3;Q8^%τ:䤴qؔM6O3)2+e\!8jxpv@$hB'2JY G ? RKb0mXIBGXCNjh|wR6Q 9b!͂1Q4x$FHY\ix=pE1~#r(L?e2\θ\>sifݝ[ʰ53Nڛ2+rkw:$GjFWٶ&7ɲ)bXGsQat DEB@&̖xr<>66i9KB8ݛn&ҁ1Ekc"+ԯhleR5w\A~I'ww:̔] ܹUƭa.R}]]_߳BT;(>ZqʻU\wUh{~"]"k2u;W; (aWKAg GhEA;_d3 މ6 oը\ݞ\ƞp~7kBNiD2 :(}tmiV~soIMˀkhc•v.ݙBH4hSH7OĦ ^Q[-irPoV A+b*:KJv | A_'( F0_=x:OBcOQV40 ^#7{ _=VPTFwY𛖿3>|Ay8: ACTVx>T )/{ Ҭ*qL/_z8y|~6T⍢P  0#(7*')^ 7!"s4 "`oXw Md)=vըm5h Ѥ9AjKhRK`\f_䮾fPR(m77pd;TeayVp3QfeeeAtUe^[ppB{:sr&WUG_WZG#8 M}mk= FRn;FvvuS~ա T.ʌP<7QJfub}>7&"+jf"2`4c٭FQ;q}9Xh47 uQٷI v*͍  r6tm Ի=P9]w`z{_\NlynǡCaRcC>ö*1Cz1Kx?໹əѩմF&aq QKܕ/` 0W<3ؠAJ*Obd*zO(9Us[&xu:BXveدƊX˙W8%װ4MDUdݾ'/܇!(jGyT7<Jl3W454D5N3LtRҠ=[#i`~A ,5-T6b;ۀlTq 앁R؝UX} de3,q\W&&Tm̚-4,߾u/8zJO}XB N"1(U>V>B J>ƪù"p:  G R+;rV<$)dy#J_?|#U*Xu&빏zF@0.\kp YV5',Ihé\_6CmiS!wЯ6ؾyKc oRNЩe:Ni pFʟG:Ҹ۹-NMo~'N\iU0T $ x#ٌl msl\!i#"#w1}Ά𝹫Dgl8 )wV< !q?&2kxv4(8M++E{v."tC {Qr/WB;pr㣈?xK-3F?'z6F$HZYhz8LlIkՕ}QPs9"NE],#I`T-tyT#p;j[0zw5ׇ5HuG2B%V5@R}0ޫ@#0PU~lk qlrQk=S.̓Cp}~I[^mܯоޚ4|u0B n\qϵʜT ?yǧX46j.}o #'#QeAovR֓˿ɡsޟʃ #T8kOLL0NHz0lvL!zlf5540t"llx5Ά} jd͂L'>ߟ:C Mvb[CV`L"do(3l"Tx#洩`y^8AqkJ}}-~\hh~]1`Oa N+ QSr{l;S FH<C]hո m(%) .^6>ǐSOb6|.򎡞7wMl$U*:e`4 Q͹!xNB"A i.g-U r#JLzEδb߈B[CA)+^T߃-m6/A>Y.~MGew8PՀfkݢӻv %_1- -rq};KPh-mkTz]IuÙ:9M[fqƴmi^Tc ZW8AT*h>"xj񞪿Pt=!w߹3egʹ>\HkAR!o9%͌揢N^ k5;K3c?N(>jJMh+k*poMc"=|MuϊbOKcʽwQ5ޠ:2LQ~k(B3H~_1P0Fqs D|֨};/d:o=ųw^h)ofG]qWKje 7oMrqZ*o|7> a%.i/~ -5T:#K!bimju&ϓ`ɅJ?_|N#ilcdlB\| Act$NG'zFUkdɲ@N˚ XP Q`5c,[Y|>W,ear5jQA8\i,L-*qbLCF F,$ I~]M]qz}/_sٻ)ڬdA!ZmdEe^'j`rKH6O]Dds r!Čc4W. VNK@?t6SJGca _;uQXWR=Q|MUR~ 1cŜJy;Cgd6PmX? O F{=^˶ l/W]>ґR?c0 p冺!t?^f\Aq}t/MΡŻ_W #6Ӕe(˵.85'0.kϫ6B8`C%a #%1@XuL3' XޛVoBʸtA>&hO[Af-œ՚w۾#Ӹ&"wJfBTO w%7&^DhOlUlf JUz!A, Q:|\&gR;'K3p͎LlJ1R6 g T#3PXNnWrc-3|"2j mn7ZC]&O)|c|2 z^3Nj_j$T^|aZ'M2⮊WNx|r V93=c"EQd!7; N~[c/4rO"#B/ow_VX/Y Catw Dݒ]ݕjv@ cQal]3_h;}/Và %8,=dXfi1sEFu>6WqdV`Tky*`Fp zxJOݒ:\IbtH7 嬿#s^صEpa0c(\;q@eLՙ?dۊYsp4p٢I,VC"e|Kt1qzoKZsj:(]?b;o4N̟ gD8҆֫'u5K*P8͈s߮iH׷h/W~m*SdLW`Gql"7EEH=7Ie2z#Tj!IƟBS7uphʿ[l^pw/;`tP0 $0GŚ&.ʝ )vO_F~G بLR r^km^# q*u0z, 1mA̕j5Жp/`²T^qҙ+v1!,\HO-e+$SYkR'jUZ'ѕ%`MhFD,uɌKʐ \c=r%? c.hmY&w*bᦎѥGU64loLtAAVRu߄(d@[}卹 ׋G =xHUs.3H 96D`Ă- _6MbJо"*w\s }| Bg }ڠmppKp6}mHA,' ]p޲1 I/$[jtuRGWq-iذ|M+a\2ū:c "Ƅ_[$Q]۳f1"?m"$8,v'7Zra]b dpq=He&П-#ڔ40֊cA?:K=P &.ENX{,>Ӵů٢$wC7ʣPs5%)k-I/ESE{- c/˩$Y,nG:z̝hH% ;G{{Y@fUɥ"6aTB\&d; nEM}>>b(g0"*e|l=Ι# UʉSfzZde4 f3!]#]7$ٽ"/γZh ggYfB_!GqnnG[rTK9= Q4#^J<(@.G;uG~%ۢ7%0茶w8GU8, TfGTlS z;MGt2$<փ":tcqЩZt_Kh8)ˬr7/=u]}s/׶N09A+b8(8Ju`eSt9@mݛcZ6[8]u-6X=OV##md>DnƐs}BN&XD0Tu.j&?#s_kڌDeHINVEAO">ϭB}m_-Vk&m>{pp_Gzn9hSB#svݿZ8nYv0T+Q#LyeL e*K5|EM5/%NGiXvm]ő^j!(QO44^b#3 UWЗ ߜ&͘q֎o`PcbFsԄIw[hĵ64Q'+ac\#x piΌSaEGV bI(?.QkemW,U5>v0FnM4yQ>V@U  H43t q;"[q ƪc˂)Ԥx-.͖Gi_x!ƈ\i]ﰬ0ՠ?gdxOFՌֆ Sѿ~J hKǖŶOU_Hn ha2'<Ţ{Fͫ>x'w Dc!?r{0mi^,ȱ{g')RD?܉aֽX3fSX<̆3^6<3-odzၢ;WxM)fZDb<$.*;} S񽂳5Zg S߾&%NCio0LRPGkV6=œ&_b h4 ޜ\;]5*jm  H-ws;9#@I oMx3l-.fZᯢZ5%zQwEDKƩq|[A;^t=RT~gkuu3 'ÔqezPVo 2F *m39m~3Tgp47 7I6W*u.e5M/Ar6WCp;VeXgWȓ'Ӟ˯EֳIK(V:'n@<p+>MY*/ ]ZPHXݮ v4y0<H@O _OTW9();cH@3fUi}Rǥ͗?n_qƕ0514H;';F~ՊMf7JsrxJq$y(m_yaza9Ϥ%1w$%ͅà/%Zތ%e0CJR<^"ci'dmmMA/D<AY=l  SQ|F'3Um\P>jO]P<:Gy|q.:h7Vޞ!πɲXpt#bԂI8Q2AqXk{H1ߴHm׀JPagE:z"ǩ{:7&d6!^el/Ft5xZnذ>'ސ}э:JrG ĖJ) s8>ƾ|`8)ⶱwoyy^ XIz مkE͕w)k<߈ *w #-WGf J,&zi6c>clpHRbv8#OH;*4DŌv0k8L&*8aWmm0B»*3CI͉4eɫpz׋!~$u n4CBgj`Y/ΫR.}Ba2e[6"i_(:xV?csG-i񁒨ͨ >)/p>mR0=I$Tç'ڊe+LAuK[DEt-.Λ3ijEvC8 " yF7 VB 6)wd̿u;I܊}ͪC ɡ(]!ɢY6(c0|b̤9^/1Syu}o**^BjC&$@#Y:"#53(2m͉R! ĎY)SsɴС9+s{IĶ|9W ~!%/* g?O}~gʿ{qvt}Efc Bpve0d6?@q_˖OߍI0Fw+LIW)VLe,od`ڇNw;}$=!5OKNP)*_LbD?nq]*RMҜ-/Q>#,Ei8}$ z`*zU ~Kr%\N:6 f*+^[4ENyP择~eDKAMIhӯY0ҔJp7MJGu({`m2PC-1]<߉|6QUvڬk;1hE|p]o\̉SGKB c`kU<9B@j2G* fL;+`L̹q@&9s|~>fQ#Dk腑xSRkߔxy! h=+1+1_纵#iN Պϲ]=NCoqd 6E># h)){pP<5I ["|ŔͶf,OBD4uÄSD{tP[ 8P!;68b9ԭMwF:o؆A W8sjB7Dm]?c[4( _>0%*g՛)ER"K4Ht Xvi>2"ꗌ~qӍ #acf:!GpfJ(HE0m:g wgV4Q2`Sk3:m4^Xa]( sj QW}6Q߅}[n8%="ji@3S:`?U/VfrF/U`Dd:I^0%LQe<OlK_yb@/ċ*ÍM4.cu#+5l ʰ=\)u>ZJIM_8_T*mb_knS,t6uaqgiT?sm` v]?dBӬV%YI,*g^5؀Hl=F=&s>,:Zȣ_ _gU Q{ͬ:o| sꪤM{Iid`]6k6\ G|\nѩeSFإP |z?'#\Q̚UZ nKfPeCo<ιxjs`X׷ ='Hom7qħJ; gí؆N *CM6 w.Vg?c:-~,PH-t XABݎص$sM *6 UA9]%?} nd)(I*U0E=deu@ǖ-*u}q_.Ҳћ,YRvմCv;HvA!m=έx#7Bzh2Z$M.k^ Fq}8j[LW㲦Ё(]rCMMEdlDn7*'tz9 xLT5mIx?AY]UBKCeM԰8ʒ^Y.lM)W7$A@մ뾊~E}0PVdGIeR_^IrHdj^t4~}2% "udo1++cIۢxdHWZc"-$.iȩ #@NEX 3do4@&qPUY ĵ2ܚMo:apR O2F_CAꕷ]TU'WdT,K19~J*+m.fdBhLP<(ˢIGK<I{]Gܣ|`m#Z+֦CLN^%9pz_x#k:b{ d,TRs;=QM*1(".zuP^~΍Be%=N9 8e`&LPHTBCwnE A0M!<>q2rMJC#aG9*շAHc,g;X}@#R' "TyLCZBޏL'2wsg^+x D*[%"fE[qYL9@zT`oAqiB8P:Z>veL*e*sWJۧhXKZbnv Q>3tFB"|m.}N;E(bbMN裑}B21R̆H{ MTGH5!?Tds)i'n\x-heW؀kaߎvu7,(/ڞT/Y@ Ot'cH{Ӛ~&f`V0kx0tG-Xh9_:~O$⣋`׋d(J0b&X(-V ǝ@Z l$&$*MK†k,b WvZ?X3$nh9BO"MHyҘ&7)J7XF g*гU%^ؾxVZS˔>SN?Ϣ p+7rj 6饙$?kS_j@=ivNoа#*;L\q[:uPpO:ٷXG6t hf`VUB'袒*^f4Ssg)B;jq!dE .梇OvKj~Z8UMYU[tYl¤ZrvJrXS5ƒ*2#2Eün9neQmzĘ3°Rς t`b U_t?-tSn+T!: qН!ebxNc)ko޾70 n`{r"D s@.tv_'`fgBWf.@8N\̬$) )3(uBY'8gd6dE4XY]q\|,iM|TL ,|- ===P*րl 2d aGʰpqp K>)W };3l*Zo9M3~9.aWaցdjcwSfXk;\,`S>6Isi%̈ Դd=/7D҃Tg\1ܛ2rΆhB"Ykֺ911)5(tk"qYe(+@M+(qGȌ놨u7-,fgs ꞌm-2-:>{ǕQC򂣸9׫A|:+: >|cHLΤAGaI,ib=Gǒr]y빬P_K?aGJڏjEOܷ f ?dWA s.noOphMtZ DS-5Ip Z&g wY> AڋZZs a>TpiF#žb7F3||+9{ۥeey2:l ,.x5] (R.P6]ԝΘ2:% O^T۶tCW|t,3􇡢{fww$7E*iAo.-%B+t 5;4vcx!CAyFـm0dMߔBAO*RЋ~:B`kH&e޵.RijZ[Y /vsN" M=TMw B P;{43͙f#~0̊lYdFƣLhfWzQzP*29jBKK֣vmٔlSʻ5h*HSVDŽ m ;+&Bxu#DKݷ4i(%XĮlWE^:V+_څ3 0@(FY{X[ZJǟch 22{(cT'wqVf/*%{RD- hz%Jgy9%1kB7z>w\v]=2Τp3lcccִ*Lu]5lwN/uǷ7K}q[7R+.,!o@)1P)ة}Zy'&d!ft Ӏ6_k51Or5`. ˈE#ʢ*ʡƿKݸU9Hu"sK ScxUŭ|I#\׋n~]6{맫/ǂ+0gF/NbRcFWʓ aciw !ś2G'=9ZƗS=\֘tB38K+] pşV, "9Ę+8Qt40Nb.0N ]m(׭K{Ŏ'r KB0+I?;MVS4}yZ"t5@°>/.(5OY,%>;~<{`2">lcvAvLRtbEM^zM%6 hZ&"Uy.-άl|9딣w,Ev?pޢ} WR0A 5.%f]7} 2{*͒=n&sd4 fܥs1h+ю犪V+s揦.lɖf s%vtRϡxͰ[/go]#fߌ[Ɵm~li@JG:$%sT3 v:aSK"W05W¹DXYZtn! m1b{5_, j9IAruL湅]^>d=$J ^2#Kvx3Jp"+8x#D/w_3 $J̒:vz;c^D1j߁u-xQ(ű>yk ՠ(L:?apuroau3qSU6as&wU+1vmsc,eq0-_Ïa+lJ;5o}Yd(*(Q*B1E<̛r?|%U<WA5?]p xhAت< )Sb[OTzL%-@N4Giqa޵gvφH#| z-l?R}G^jR3s+}I2r ;!EBKA-wCs宝MfqE.1$u_vǐ5|}+4\ϖw3ӫ=vwsTM?7]%C- fRh UԨ!J'Oۻ[Qq.%{h0K.mz 탨׀r=Z'H̷ؔxC9"Y)\4k.isRo yp^gfe͡?\'*I! Y RTfO2i _D[ mySM{fkǠ `vG>8=%my62l56^8vA4ت4nк˝Kb;Ђfb!̮+ޔ roXqlahA6V,:PedV8(sd^$^^XJN̄[׹\8;SBObSCbOJVQxfzjFn9\ο2yz=-&-_+|LBwHLNQU2hpF&Fҹ h\UFվ"_p1f(P>RqH59"v7_#>P*YfZ+qU_.rgkr#a :GP& ,66)P۠ɍE_|Uf]OljdOp0jO& ֣vӉ9_JM?+]71$s>R@LV_w6rNjuD%ɫ"Z|h% ֝RTgigdc9Rl 4ILtq^Y FpWu\>R\N ~,&G1Y=a jTwhqrR'eM*#1%AZT'ʗ@ JF~s:lSl°?"Q>nLJ[kﱊF(@yL Wv\ 3LSP_Rg,9콨MƝG"^8 z]^hc ):a6K35G*ϣKԼ=>?-W(}u{=xAkP?4T:>D"9"v^B>V2(UJUTgckŬ$HJ33,џĤן=L%FL gI+&Iu@]ܔZҨ&+ߙvoJK=o|1ObɋHڥ$,_&00B8DN-Q:2F>*J0KO@h)pϦ;a2ٴa`b\ex L."Naw|MglNӪjd42-ŭuW)=s_Hc4B`9,?jĘIG_7o!lab+yrMES47is栘Z.MwZ˰!0vKk ]]I |gаH HǸʊ=7k2=A3N`ڿz/Ly7SKC,wvuR tN}Yv63%Ȃ+xݵנS Es58wmsIܟ;%O{AK.UNFL=4]Ċ^!C]<›3~v5$dfl>5S8~!vvDw7` z- [K~#~Tj }XÛFld9@?~HݫS1,֤X6./{ɢdWia㖃p\)aݧR ەf>*s?^~A׊u-Xb%B)7S/pU^廋oqnͪmqU+,_>}Cp%+KW}Ë}=l*cZEQ f3zI/ۈ(SsysC?hKx[H@_a`Rv)ZWc.L:KC{JALPS5ibh)ymϕ-eXXfأs\ *v,$T5/v5[E @:a{/QUWeZKxqT9dCڱGg"FtX~!I!4 @ MI ,u:E}k W-syV19HAUerr6t!-R|sx,B@䫣6!sFI+(Jv\"5 )A5.j%hV1gQ1JOAGh}fxx[s ݆>rX%hՖ툠c>Fxy{^Qaj+ֹ.c*I*mبTLulBGpf:q$A1氺Y*8Pv.+r>@U <4}^^8bB5hǀa~=ɺȐsYLM ]^"r /pnbh Snm E2&{*+N`3c2{TW:Bo^ӠluŽWR}`z"1`ŽhƊ #p^ߵC-jNI\eв醌o*)\ %hsa-0.U6"s[YޠxݸXƄc㙃n"{[0P[T<A+:<ȢbBu$ gcSo@rwTsjTT<{i6OĚyTKx*5K[~C8EX M6=(n2K;C~.(ٸP 3+T[Lx1r>L݇AX#\ bWh]=d&pӤzJNilr Fk=vK-yq3/T~.uZUt~rhWZ{g\Uu?{o0nIeUz*lrR暈<&5*uJ˜+!Vӑ\dÅ;z#D". ?G/ W ԉ/3ܭ/m;J,W x1}S:foF[}WIۛ[|`w0e X֙ȘY$X$)$3fO0LQNJƺ`+/\YGU5M%^5lk;aW4;d]sIúJO uGQYEc{T~NcvradQ^.Rfs}P޽7@gd, uH~6ω-I7 꾹]ڳI}vzXذʜ&ƒkJ]P"$[zʜ$Zg*}bd6RЧ ڟAڪ8B96]P@ 3ДxEbstn泒pj~v_\Pd|)6p\-l ‡Y~`\{4i? MVT?DxB# =Ϫ:x)S]ګ-"p%$߅ b1"O5s=;" 5HKo"X*fif2n;Я\C~x\*Zݎ^!$Gk}|3\b7/]u`zҚJS4,rCJC$#%Ey:" Ҿ`BFf84h 9UnY\DS@'9%pщ݊v) !^m:dXy]L7'Cm<s-<g^ ީd}3I]LP?E2e 9DM6;[pmiZy: vGg/-@rRd5ݢ/WYf>|{&*Ͷ4N4ƒSnȶ*!2S;k\p3b͊.8GG\=`H ,#AJ#/FO)ϥ, TXYy8*25 Y3B|\/!6"(^IkXl^~T/¬r;b!Z\* ) =^Ļ浳d]? ;,@ox*2Rˡ_ Pb63iT}^  RdK"~~E|RdC vb(:fncU |ŽD*0.[(&݁ X6~Ug0 a/X/=ivUW< ηIS:28^7tssǹAoU]*$(mwWwwL%. T)MҀ-ćlv=;Sn`UJ\6`H'}wbyoP4S7|\ n]tO%|,.!C ͣc}^}ҨA ԐY%T-yr)j Sᇔ]qáWOhp!0X76}\Y_>n2Ip=vW>i w90;3bT,S|E'dYk6Hyrr3P{O{u#'/m/gi;ǐk«i5{}hT>2غnVjDEf_iX_&̋Ik< wH|Ӿ[@l^T ̡8Cy^?W׿6/E=:wFLBXT핌P6'ZK/v!; @R9ٸ%RVf|fHѩЮȻ!m×LZRVZl㉡ѳ7|Q`3iHS9D_|Nmt/d%Iv먑ٰ^@KXi0)0DCUCD#?bF[QgҘ><d@ q" Y`5P߾i +<5= 'H3Ib'U.qx u6례(C*zQj+=7[Ph+ò02 9r޹ S,k:^H0z9åTȝ|o9OLpboLqHbb^Kt&mP{HLMK!cq DIL@bL&xeN}ݡQBi*U&4\]b(l:/,5'EC~v:K㨼d'p nMVZ?>˚C[B>Yb ;DV`') `s4Q绢/V˽F(Pg<.-BSےt`ΜJ>^d0s1 _)弪 TLK,}~*" j&[}E-I%Oe_Y<6-AaЮQ:/s|D!Rԍ?|*ʐ&4>G",l>T;q$<&L,I9v%eڀR&Gli@FZzIҷVw˞ԮN^%Q9׿ֿ&qGK*GvEWsJGሗWJd:{M>se)ı Wm<|5g@9U4}ҨSaGB7f&W17UlC\5QRGdFm06+vR?}h-5PaRa . ع2( h[l4![sZ\VWuD\ٜ o`RƢٌ~'9&X q}7>a0qk6F&u_@}R#f>G%@ ߿G`sٿف+yi~xNXбт--L?ͯt)^o GKowվN@l7_:"|`wC=-?ޭoqzƓ@͆Xl뺔ܭi#7[߰U)S&=P,pv*QEʷ<b/R T"ÍPWȪ-!桀,D\8U(PC@*p|vHiV2}vxY@Q'|/^&P LMk<]LmEb$5Dtc=ߐ;B&€:Ҧ*vGzH{>_!P0¥ Mi)Ga3TDaH2}ݵHoTH08ٽ')ݨX/S6mwjE"42|/\-)bM{U|duPԽ ʛ@{%@Ǣ9';RVl/nBF֌ NR C .q):Wr䝎n_>Aއ]]ٛd8|-XV\.%uN##ECRsjhq]#al *7ڬ@8g4Qk;abbbx ˽<t1c堾oղ.ۂ/(9 .3m~ݎ:_yC%7Jc4 -?HɝNkUR`UC]b<{P네 ;N՜I`s4٦x4gUghJzRP3|yCH@5E%xD(6^O78ԫ &&}Y2eO !$_vABk)5r446LlTFf9-,|h[Rlw\ =*1@.$^T-'|ke삊XL6qM?9_kؘ;=R!aioeEgX?m hC?ddc$z+9~:]C9]Dz{D+aB9.%})/@u~5W# US׀)u7+(r,&i5h1ZDZ/W%` Noe_즖buC<*&#n.cO.PwE6eEÔD!h1#_Y8ұ Ոiu$yjhXZD#*uZ]BeGe=b{1?ӂϼSʟDNy?% X!{AK?u8?M"{Eo[l!f1tZhO8iiv<i,P+Hu]r8Bܒ:nh~`G\A{Yoxig=SCꊹ,XPY4T+7>;]4HftHˀ6)v?YF^ůީ[k{`}`o%i<`RiOG0B އc}oߪ4DI!XuiN<s<韩4Pl$I_aj׽orZ7vxiGU2G,r|:Y<ݸu4ϤΊɍR\5wlֻ{) +RguNŮ+UEχCw‡\ .8 mfJM;I@|A"z%c%UfGK pKGf=TL)|' e& s 6#KEU_gyofYxF|sR 8ۚpKR>{[ɌfKߡ3.Һ; #glP2&8{zR?K{Gy߶?_glReKDq jȽ49 `(o?dwYstL\j1Eқ}vDh]heXлP>xԬ\ei쎯0iK:3K˜[WZ=VMhSAtֹ8& 1W> ^?OpRNnfT&@N{ȿ=|\4K\nCf̽ǻIGmQD}mѷ8ts' _%P# =} .ېKv2?"qFtZ:nY*9VN7Bjн^l_썽ǁ XN\ݎ]L ZlzY @:P ;f6:Gp]neuZ)-$$ci[*iut1usfôQƵC'$Zk8e eS[G@ALA>8I#I]ʵNN v?A&8u`Y^BG~J񮣐<22ͨ܉y"#wܵd.r2Mw?4B 6X%!az/jD'Ɏ_:qgyTV|Qn!TIreEe{76)ÛZ rgnyJ/KM-Qy%a\0OpnT#B a`П 4hB/r$A2*2e\~^q<!xGwciہ\l;eT c1Eoĕ2T6t z=\3Hw H8]_ 0cΰM9gq.")<Mb/Q퇓n~_nNAw+d 15%)kE" ߩЋ-!&Uq}5Mk&J54m7?^ȏUH\<e7:K$ L; hMH!w2 omLE?TZ3a#q5 \[1yTzͯӊ2`A=IFw_}Vk*僉BG̩ ˞q &Ts ]mHφVg;1ޓ όX,A}݄ĭ'n8LP|`oJ0՝Z-}J%-ЀKSB;%ia^lO-s]lF3[ P$~^KtS8MKJ?|#SŦYˋ#{pmw6*lyq̛ȴHh`T*N1+:( es9ޤ"^GR| 4WPD_13d)Zt4굔DŒ %E"acM 鹇,rWG'VrJWdrݼOy 7{ `0 p O tpN DV"qfDaJu"x=&ͱ㲞.ee .w$aJ.t[}74X0+1O7?o,6CRwSf7QPB7g[zVc\?9xnB_ةnɋK\ڔ KOCsǦ%v* `5]Rq v{e4t<'/{9Ȃw̓b v fEZ݆;IֆU 6 ^0jQ6ѷO s$gu1 q{R@ֽ|Lq0R9r_c7no> _ڷy릫i۵kmFY079)g[tT[原0M]as ΐx<4w*^/Ĉ.sO~pUIVX‚Z][oèD0j.^陶 IK{ \jٵĽ;xg}qڊ[G'f{! oz8zfainqdzqg#2,%s>t<8S&޺?#KJ2 xq8s{6a]Lc5t%t5{wLRS g7j_lUJ?-n"h!-Clh\ >z?m]?N3b15:0N1yGw'[4DgDHE2 Y`[e?j=0tqHM9*' /32%!Q7aO>綮45pYc!)q $_ N9]OgFxR"Ŝe{@V|^.: '5 "ip@|`GZr l>Wk~sZ+q(5 b7gò6yl=XXeDiP +~BCɘ4XZZn,l;vV\sNdĝZє9=)$bA=":`K@kouC,üӤ6eP}^3NPRZ%Ǖ c jʂyF,)VZnE+`p{;WX?? +OXeW+~X{W_uEcg>%p1TxC%9PS+P&8yG$b6eǭ- Lhju։^{ (xOKֱ٭>an{OM"y p4rߏ;۵A)ԣ̋Z+]k=5ŀm$nK$`S%:$i5z^Q|$ NqqHp|CHDc h lӈ_?.AS->oyxdžwRo2DyhveRe;`w^Du:Q&~w'&K*u.jC񠎶*, Hb)7M~D*Zj~Ӏ'TyhڝEWDQ,ҿbJ!nΞ49"i)O[=q֟)yKs#y8덅F֤E@)g)#j%dBl \pF!a3t$MY]=<B~*^/ _F-+ wCУkd08 #ˁt 4$۰-gcIyA@3{XJ9nݚ}9`p6]QU]n21zѻXZqr~B,=HO}l'q~4wt)&52ҡrpO5 uCy#n0ѕٽ^Z-M+I^:/:XfƏ*r1 1MPXem; V].[F};fldM Wo.CH_u eieͥ[S.W{ZcO| O+Q)öRcY{XW=Ӣ cuZ$DrW(S8AFپCyԕ e|jrCg,"+ʟfujx}wh,#&>l9/ 9Ibwn(guĜ8"`za/Jl谶Y*R gT߁.j*oyi]GQp5KPmr7m|G4?+ϟ&b@-N:<I&o@ec_#$,q )/LR˕z'!. D0K0c O>O(?fDJp%[^’MѸv֒uz1YD]'JLYO"֩ZUkÁM'+ ȱQ:.:y49-&$?C*ιCka)xnj_чи&!V+ӽyL QmնAx3g6pΤ ڨ^E. @fd&;܏q?DtUwߑ_ @ËWU&BXd$jR|B4(tmoX.x_AqMY݂F"dUXaF}|iG*pL??$=kSn܃+`o7:x̿jNT .j#wV^*#RgWƸ3 DyLN9ZO{w.g)YwId~8m2Y,_ {0+*,qĔsJ# }{zW ^TtO8 CP6/".KxP;Z/i3Tؼ0O/ JjYlmC)7j5ٝ_:}sbo3jVdj+ɬ(,3^6g y=j0u'gjL83~B&=U( /zܥkVU1Қِy޶M;FJ6 |bDw0[)(9ZZ$qCi+ox,cW@_ҼnɴU+7戧U/m 4b[!)O+@~ス?!O&@&0Xmf{ashB>;_nɱ7( )Ab+E—: A,0nUۿ^7g̪Y6q:٣;_%(%'@ƤObb LdztFH(n_ cN 7=Fk}q KCWt' șc%)SFx!:N =Q%-HO(h[ _]HȜ%p[ ,28^ , }9HUޗrg~ssF,HsFzK# d̀R [<~Ku:R9bSI.矖,'gtvق/lX͍|̡3{ f qLuYAnpSCsG@vJ){@zq9z>1-f]Zg|oM>6:EH/Rv sEwee2Q-`a`k2;هx"yqA):7 N4%"^YZgY:O V%uG9fOl0 P . ^jWF(!ӕu=d 8ۃ1S?@emlRAP0ŷ57B}HdSu,<.vWhe7jU^ b imqb7\yQ2P)P"ENسeI>~j<| +_\~DLX RqμGY07-PͶ3k. o$O 5SDd+JU6 Jl}9!A<cHQx)u4|;`h}wpkнc'i>E)pC>#g {7G:zt p렵3S !.lƲXc}?K01'EGۻfk.SA/M,1ۂVHrg-36=}gh yڧZy`ߟD6tO{0!y r>dwQ˂1qj 5xIUQ>ӍVLs@uIK\yWvHmiH@jKֹO0ε3| *v'=F)E:IxxE*m^/3DjY7|We:FxxP^ 7D6bf`,3Q bÙɠȞg|F@OF%Jä'ǟW ]^7 pLm:;V®:A% i⌄\=J'Aŷe2|@jSO%h*czlFg )q [0Yg:r9Bw# zi`Ͷ* r> ~2N{P 4,aFg:$NEM⮠%І|է' P E!{֏ w/$+=aĚݠ:*b1|eㇰ2_#V(\fڼͺh̆[ $/P|L]ym \K۝tq$@*B6cʬ)P%Ktd-0 %e:<< о,#ds~R2-Q@q>)QG]q"\ikOuZ3sM y̪ /TaI($}U0:<#%":#(=;Q)cH99cgEVQzϼyv-N؞T{bc_miDЌD(J3Y[i񋗯;+忙i2I*fk9 R˿sW|H\y{bᵬJ~.e=C5wMf-Gpv?;O 6;`F/à}A "*,XfNgw57X5OR9WCnp&s7Qdbw;OњG&㔼2ݽjQб˷!o@~;̤Xevgg%tK,3$5jAqi QEZHxbhՠ sVL'VfILvԢx u-ZEׇN^MH̠ЗG`^^.tsJ% :zmfu!:]8-lneȥNFR8վWkm=NAyj&JLlxR,ٿjşQ s 1gLeF+\QJ hm[ RBY`G.(IIJ"4ل.]mIàq`O.=Ni'1vWZo:d;2t^suqn7-o"b2ʔA_X@_tQ; 6KtkM+&c_̜r2e,QEax.Լhbfd6%PtSmVʜ}g\%Ҡ#YM0Za ۭ[y. uwKLѨ\kۘ)sDᛥj!SKWalL &ڪ&)j4:?\"O-tl+cMirEfvٻIDϖ{wIV>=i5SQE T ؠd Z4/,Yr 'J1w/Mǵ*(Nv+PQQ}Gs^U7Nc}@=d{D RDm4 +ze+꭛@-:P0MdiM*P/9lSgR9-1yz„lws~ugnjbENQ%KgFXKBɡp?gQ£Ld"4Ԙ IK:*/{.R̹%Ss5A5OgH703Tӱ?JI|R*pb}&HPz<@6vQ˂=NxOd#G6nwJ=9b)Vŗ HWV4 ^~6ޏV0yA ;=̓^qn+ sK6̶%W-Lt-qjB>S1MWDBEDYЗT08TF8Au>j f]B\@1+. 3{W 'ڬ |/tK_yx*ߢ<. a?3B۞M[v7]t,S/6\w<>8|dMqF#"E/vۙ Y E߾Fz Han+MLzIy7!%:ǷV0jPh3aXj xb5`N#ypJy񼰧=ԟpfb0+ӖLoYI!FYILfKp*]UT}(\5o&xh,T|><{xyh俋F *G%ΔǰK 5cBC\߮?36@)Co#=w<2IhG첂!̟^f֭&㛕n }鯇%-){ @@ B缋E&Vh?Asfy›mY" Nên_1E9/`ExG}u1ԑ--Q/DҎc8`\y<R\08syҦ:y AD(Нz'`IT"me飻W@/Z囅^ ly `bCJZb02a O7[L,F3#6Aӯp(Z`mUfVP'i( ˓,`.Ur-Jt"fK|Q?:Gwp)C;n|-gA$sënyyE8ҭjspW~r."Ypݥa:m?k9߼tA f$ DJ@'` G% !am-2l\Pu޾T4jp+<,QҮp, 6,rp(k+P}V?Tbڮ#5Q>,PѯBa`s0_ىNq"O4! ;91Y$0u=gWߕ̆: ȳʞBɯӱ,͡g0ֲ.xuzsi;cH&_!~gX!wn _*B( {F7֍qVcSPU"#ye|+))؂+&|9àgёCIY){hC[$%R KG]'(i(^@yW0Bl[/[t\*5=?,-Q[]5|@R9\P,Ɠ(0.~>-49yeƽM4˪fi싌Aѷ3blX Zʖ8%uJ)ӊLL~e@e 0R֠3vBzV{?-4WY#aI8`J(9ڻ􁴸+9E$Nz1lF㣼N02Zj =)sU /' 8m@*_gӄwO2k%dK'Kos>A,OA;&<%\c|oPXd!%g,6$9>*XRNp{(=Kۉ:q?G䲐Pj1m2ZdjAn 0_}C]N {qe Ե7FN-uS,Mw>+6b<-@4⽂VH.X9*rzn .cC8> {y{xg.^ۚ%KSW4Td]ͰkąApL$`P7|7ŴInYN`yjO𬮴-g0i)NDw+7 q!Ū]iVC {bه^RR1/PYX4^~[}Gҫ7ğkf.ȬPTFۛ&PK5G.xdVɗ<}b8c+^&M,(pa@V֣}MGύPdN!gW>mU8voF߆kd$}8o]My>_csޖqvN#\v~٨80)NgM[fmԾ.#yԞ\r[(~% ~X ^c|,tQ䉏z2>_mM IǓfZȨ|ippkGd$Oq|eT6ZYRV*6 9:?jHJzH C-02yD^6 b3~`UK?y>\:&N:^ʸ-Oű_2%栭SvxtVЅQ%Bh^P ƕʮ%U*k^(shC}alNS)bj"?ׁl"_ug;fuM YrԿWf7-/j =1`QG#"ZCuuZj(mY`n_l?yxX3* u$|nNXnFG'#,zK>ȐϫߞX/)C63( ,]ЇڕD_)%uȞI+.ki7Ƶ(َl8kwg=JOǵ@n|dֿif %6 =zNl>4<a[ h=9\{Ѻ#gٙ-hFOE]$K+q jhxے$uim?ֿQ 틥.IwQB %pߒ4KGlj55o]?LglJ#˒y1Jp!/R l)Lfu㹭 !JǫQzj8/QL^aU♝k$`l`g'D;̂(5ulF۟Tjҍ\Z'6X^lJm!TTlYNĭ˵x3eJSMh6(Af۽Wj9T4=ϢY+k׋muQHCeZԺKddG”&'m?&@i._Pl@Mu[(WPhr` vE+aݐ[h|Nߣ\|aT_Os< bs]ÎG- 3^z?URhd+B7f%jcϑpyzh2xd;) )+ ًe a҅-_)̾i5ER2. f*źjcVD"Qjh1TN{ٱE%RI|ns4A,}G3MIR m%^vzt.d IRJ{ÇmXgޥ26.Np\W θ਷tiRcl^ɿ1:.z 6.n6_$d`^^˙%lVI9ܩy ezR דݫ)u\`= NTh"loHu D!ZQIzUt,5HsnQݛ.1vWjMX?֖&.2y%i:%{CI"Tc>&#FɚY /%\1 &}0 $q1si v6:uǍ=}?Ѯr2nH3Gp?UY S֢;9AUC+$~oj@ Q&I y }:_rkg:33Bv~IS94 0' הJ7 fpzkuD0TNN)J1|cBdw5*/BWC$BStD!X`2ةb54Ԟ$D{)-5Y_66a!3xa,aq mP7 p2Env:Ҙ5ȎJPȐפ:t)ж?g8h,Lkr눔9TKE2AOl6 ?5~@fHWt4 B$kf{u- I±Ii\>. Aykg֪i]J,ќFpjoy|FhyH/'WVtiXdCT&b7k_l=V o^/EGNR=`cjfPc;f9FTBQ(hhdIR F L==ZO |נ`* vulߊp0gWJ:/g7.Ug)`c*lָ|_ao'la\ݚs!yM+XRjNӰ|5?fs ^Td/śNU) 'J2;GdP$"JsΕ yOEp&o=sRY?+N֧3--@/x wmd`nN35e[AT5CEO$ѱ+3PՏ]daTNtػ9?A@pa? ag_ Ħٶ80PFl9dZoU|>gͥ.;)S!2Z̺GO6yRSFx.py|RӪXfHJIhx{ ̴󞢾꣖b[Gz9ͨ0a\zmnbUBc/[C5=rfNO~]ɲ챦JҌf`#m7;B4GczC`g8!{F|iM,f6^4 tEoE]m(:eu9K3W%5k^$ ĝ'rgsU|q^f9W7Lܹ; Q̢@{dþXxgHxNj(VLL{<`qo@hAy(yyn*Ez+*lG7Mwu/co_n=Ih0 f |$$s.ԛŨ|('19\#ԭQ d'D/ZwGN%)e"鯛*7 #,x;{=VYg kā37j !nٲ>#B8̌ժ}힫cG`o,ơuDݍH wRe(="ZZPAX7f2 01E.[١u; xT3X i[tVf0W)oi:TD!{W Fx)movnU *e=xVzz~ ^7rFmģ2WGeTdz'2(Dr=V6apP3hNa[S:W mpYW.6Ff,`)C*6tźv'L i+jw{@ D兰nk*~neٸ;k~PVoUЛ_|*O8بo'km'|U6~LSMޤjVREwEٴlǏrJ{CK? 8#+SkmE8$ fj Q++ D_\WoŃH[HoѴۊ ]%t: /!PE;3*WWM15,xNj"QP;ub`U}tLw/3JI~Hj?f9A&U$UA5Re",Mqs>j5rUz|Jd$R#Z%ڼwi2Vbe=6hRljM2|ܔ&_MQX4d7D P!l.?g"yDU9Q'6Px ƮPYoZ?Q`ƋaU%o@; 5j@Mwx x&N6 xxٔ xF1.c!`G\(XJ/^0v%,/# 5 $J81r$%*ɡ^mw4;H8$qCam!Pz˪Mq$ _8H>O9\n=i'~~i:×NZ ]yiŤQS])e kZNx' )rώ㌂"(D%]qt'a5j;mfm'X[dk_{zMs w̘ 69tQ_L. 9G/k{(PX/Xj_j$ꎼ3dŲ)$SBVYIMWl6q Z6"!-"r5b6.WBE(ÌQӰg6&3 @ͤ)0%2VkQ%귞=w)F䟕 9B re";<0lhҞ'xom]p̾]csX[{KJ!.oQ(F.qy-0* wR| 8J1熶u\LŌ AцXĈDD/XA7Xl~l]#6[9#kuBki,0nc//d61bjœͲrX2BP# BZJXj_K9 sÚ5'@JQ-q br "Dͷgt95յ_,pvs뺹CJ QpJP'eJ*aY"V^8dBGUebWDܖo"GT%&p$ "D{vgN JWҞ@L#xKL_<oHaLKFoR!` V˙6 ͌?U Qrc䉌9l`r-}!z=y`pM/>.i˒Կ^ P{ZKρA1&qLl,jLRɗO1izy-6=mɒ_vo&kÔ:Pbe j{lG*y偗ȏ jܜ6 cV4M,:w0*@pU xd'>_ h/lFB$(R>t_`Pb_!dJjeb1pMgMo#;bOsOo3UG !HX$8Lu][BPs/E7/ҕN{]7;2+Z;[#wqu JOeMoyxe)6`M,$AKԨ\c$V^ VD$}*<]|=;CNE+tp#j䏢 p|ʁ7|gξ=!fFԖ-B suzR EF dq>CbQ08F9ray =-ͫWfAsQ?*{#(M$Լ͗\7٥mͬMf9߭qTFp_S4e/DuPuy+9FvDH&hP @f`AJぁ!ј"$|gnCҊ7$LҴN 0xNXh:{XHx]ޙSZ*a-mv]]Ȑt}"z}O LZ@acj&R'(i= W)w\>Vh@s;ENurޢLC(- dbZ5$x̴&S2"F@} ;؈\Y.uMj]kT212aBjqU]#!8p_l{KH{οQ㞌r^OAnZ# ݢ͙FSb4L,*&4&ɶ b:A$f`s6mA}-/FL9 5ȜUyvH4 bѣG4#*Sc%*#+]1ǯ$`@&/* `QҤ$p[VsI2ʎ]d;) W:*NTͷY%Op!{ wEhh h!ȵRajwP$b#u# K|f зЙH}|608F FN_ :W/p7> AekDJRv`đ` w7qZ8TdbxL9I ]a,T:#q`℆1axײVs(y#B렔,yZT }F06[뚓&t\A +ZKLƴP&ǃxINw?Y@6j̉ΣzPVEC_n%1gx-߁0@~;***i,lntVa3^_Bu0EUOY{X(id&o5mX̴R"4ҙ>rgđs+n YE9,KLVb^}3S.6 ћ%O[is2B̵8zMˑ,BGjdұ0c?aHAV~/{f5ղWPᥒɏhC5dR0 fZS$ Y!9|3)BtS/r؟5"Pc !+K b GFB@# dQZWQ~}l Pqm'5?ÊU uL<ۣ%L {9*6uɀYn 7n٪MaO1vI7ҬR01xX~;[ue-` ^9oDžרj-"#på~091SאW:.7Yp+@p\dm[QpҔa!Ę>Au;ؖkq媰V1?5AY,ѱYƼ9o=Lop5 (d =8_Պ Az840ZT4ݢ @:eVʕeP7Ma>8ӌ؋P+￰`r!5(5!_a M2ώ}תVxh̖6Ζ*Dvˡm-]MGj6dhEZ'ut"QR# h ʬ{2 hr<xtMWtvuzAfp1;W@q zy=nx,O&qcC5O`AXm9gUߛcO $Qvƃ!Z3cGbIնm\2{"g"?Ĉ0 g|3\Or]Ѳܱ'\֔-*G{GM0 -+$,dAUcpA &-;iؒ6R8zE? #)BO6l9ݮ#fG{ 6O_ P@[3`SR89QngI>(C~5\G(&B +Ww8xJV8/] gt0FB( ǿ!xDŽ=Ya1mJDe@⺎.Lq[~C-\Z t !( A*|jE 7_Ʒޜmgˆ!6TTn$$_Ylnt-,x=Y88Zj{궐9B7,q()`^1"j,"ʾpΡ:#&#ʶT DںVn U2wFFBjW7̢pC"eg|ulu ԴG fJ}d0v&_ŤBQ='Z Ÿ`xq1+Ug͵WJf*gJoASt9 $ K7PaOH\ܼhv6 e^^% 9/`m˨•y xymS%]1`!Tq9Y.XRjpBbicjÐdVF'0Ep\c??{ FBBH HHXw+=$ *&طf.g/DIMQr-WeD)l+UIÕ6j Yr ázLS`峆l!S3H0eno )@7-ɨWg췞;q$ j0-a!Y|Ekt68uᛥNԹfke(L&<|``:ZÁA,',!1rgWYeobҡ0m, $\f;F{#r:+OC* (b!ǚi e~;D-X%& |^4&Po)6Bٳ rX2AQkYy*C~a9[ "1!& >W˶*$`\llqËa `+>=H')_LycMm8푯Ue xwb]%GU #IbMaqָG8`x Ԋ@ȡHX n0يUN4ӌŅ% hG%@:IRMƑ`ݔ:k]tvLYW)x6PLOacᷩGQ~.T@ *6j*/bqyKa@uѭɟ9k.sPqAB09 }!H)S Ӹޣ޳`S \dqldb `dfKX'{̤N~4+ ij jE6o-ۨCWQ{{e=(1m# B%( Z21:!G08Ncx5`kdS4Pcqp΅!%[`/xͿWo |iVn?ɒ4)OO{\[q<}U%)i0e}RX#$>Ntݓ'sww%<珺taFcخT~ж2\Bd y׻z \^99ҮڭϬO?,Q0܇gN}p\=>d5cg>)ORmT3\hg4w7)`OpWf{:*Ơiϯ>!(Rhb}?g{'#5jĶ/:л@8m-/ 'd 7DEcC 9?.5>DedI%|"FxJEwG+ qH^wXS)N?"&`FE(^Űu^뒃Q~` z<7*â)[xU=Wآw ?›^5+Uà b吋9[: *U| ILIPLb[WvTj ZI1$Z+PL6lr~\|99tѤxM{8P+?VPp!gt%iUV1uu[(TǷsfJpgh<*>q9(mL2X_>VAƃh_0fLllh|pgjC6{$o xV`w頩=axKPp [UػqpnFTv䘛)1v-CDzIs!1>U  9I&WgM8>?04Kǩ`֙lek ΚIEMl#5иtTʱ]7R)Qvދ8*"hG| -fSV_{i(LD9Ԧ4uO[nnnp0'<-LCݍ'vj*-XxII~WΪؙqME9=.2ϤHY)vKWpvݜ ǐG`]SVwo0^0!Qp,)%0>ΔTq{LW׃:pc1!ر`ةy#fVۈɘ5h*bfAfdyӳpu:5h/ JF٭L&+s۪WyrgƠefk:A&@I_c44[ZAē#zty8z9㲿s&MPMP9/AԦkFZ}TvwPP -(qO=.2m~-[J+cÇEܬc$q{3YqtiR9sdgGihdK1ܹDz[=p 63%do;: +nW}{3͹ܐQIPGD7x\.XΝy4`fcθ`DB2f2Gg5z4,!%A}LZ+qufV 3a4Ä,m^; s~+mp=4ځxHNfAALњm#L͘5bUܛw bGaKhLg9ݼI#W#3)ގir\7N Ym'c Sp,VK֨~FI V U-^46ioMܔb~M,{ wreT (5z$9\MSʖp$͘d2NQd0Fq[IvK {E1&shj"4>)nAS "5?b^$I,op(-)N]0sP+ޚrh-s 9\!^FtB3Jmvl|HՄz+NCP(!B@\x0 rZkmyROP&9eMJue'OXcFS}J\Bْw*}计C&uGyBޡDyܾ7Z:1F ;'⾺9T~p;fePinYdc.\5gZr%RC;8"nb] Ifn 1_iӒfk))mxo#[u_Z*╍=eTұqriĆVZEv;c-0=d(ȑ-^d&N&:hnjfNPg=#:$8qx"4VNL}WȨbnS- G8[8e[K9YcJV]TH] !vb>i$;n=HwPj >0[ Bp#Xo6 ha?bxlx2`U7wb&v@E-"׫- p{7> d㬪pPR.2AS5PbR*O/de؁K"2,ч1~VL``&ͿZ>+tˏ<kG=EùmIʒ"tりO }Ӗ!-b ni#V 6"Qe (zj-kZ^ӹ%ɚ&_G"(闝x3zk69! 2Vsqj/MFqhP= W_0 i+\vp%lh~!%V}WtETuq9.K[kJ03k":ϟ'!ݗՖJpNm(BB"{pόW0$(qFTAjad1OK (OX_> 2 յ,rӸ""הj2ᫎ2d@Ѕ6PA~{ںFu51r=m}yJճ&6@_oQH+y` v3D9dt!x73oef&}X@h$}$*C nXb+ $L8v{I`Gfq.&U0dQUZ$Gwk[ѱ",wSjV/K{WKWųn#ňΠΌGFXKb`c֭O)%OG&l=;vj! c Coe}2ש|mfZaH=iI`3yYUlχqu8*rUzdb0`D+TIϢ:P`@ U凜d囔Ɗ|׾SfXbA0캊O[zQ9uʨ9sL_ 6O2[̏RwLUE& J]-uz5cBqn6\ g,ælދm݁t!k8:Άl;XwUa~}n g1.^G{2D{{l%p;=Uxfj<7-Rr<ߵy/8<aD"ݘh>ɠEThi{?(zp2_oo>TKԎWn9]w ☍{v]b);8_ ?]hؐ %,6BVr;hxp碞3I X1+ ݦ̪nԯ[H $B^ ,:k5 vC]?~6smm|;:kEꑋ2FƃDR>gniyG2{ESa sOi f0OKy[ft2E^`PhW2۫p˵]r0y4Ya:2V\c(n u$Ѭ|UP3L[Hg=^k{PKX}ʧy )v 'J&C-㐄=@`Y;PF.TiBhv16܎ KhEɴ fZ X|˳!phĚye$bA55] =Dy-̽<^K*kWi ]fm )/eNz571^&3ɿkRh!C'oNtedB=)rGZDR7r(<ɉVPt3U):xƤ'ٕڛc`'V1%_m:ذ݌i^g5 SH:xFKUx#ldJ; a h- 0˧Q,.towxk#_Y5#-f|'*Ñ9g#Ty y `&BƌBm2\:rbrN9~M~%9b]Q\Kvyj) ߹<_?1J^6Q#NtYĻ1.4piu"[k%¸6MGςmяĀ\ *C+FS痙TUh=1*7/us0k .*Q*-k|wl󵤨\btS@#pM ;1 bN ]#i$, i$"u7w6,Zy. s.cT,KfVM[gV$:?Q4ڱe_3jXƢΠ@k3g Xʚ4/aY|4]txTKˉM\-Z1/c:b[|f1'Wb.M= 6-©wv.g'.w82޴}Bd\a:ܙhh0#Z 'ãW^4q1 x؃K귂&c(>Z&˰nc5ǝIQØ@f%%4jdQr>W1%y/y*0f C%>c6(73q1}#y\ٙclyBi[ SʈJfO}>-dK$7πjɣ~L&6#s6GMݲQͺ7Bd 3}iBL.lt$ƀ5eU[,)V1M83 pܦ2%ƙK2X)&v{:r}.4-Ta![nrY}-\-ͺ9.$'?`ͅ-1 ؐ0h+o5${_ʀ `_ y(Fn5qtn +a^+V@ϰw :w6ex6.U/}lcA s ݝYX 0])^F+I5(kp0*WQuk2[FwLpW̼)tY/Q K $ɏÍmgꎏrۮu 6xuynء63Pe 0R欪wJqCuYYtVH:01q_jUV\/Zwf7uJ99o]7^tZ۹<{Wak A\* 1B1l:%ll!skvn9A(o>q0RxU`x͋V@zx|\0,EG=}$]g)2Pr9̮7lu`KNcmQ7MLݎ2niAZy9 ԄɖXd>U[/3T(^O1v89̭>3fmImh(`cbKnQV.۟yo0wR{ch7u-ƀAIVdHϗ)Y~UWԛ;MFSk5|`]u0CoC`΁r>4Ap5;| $* iF˷Cu-N$h1nEoc`,J8%U噔\B4| ~R Y3aZkS6qL8Pq)ry.b#;8a3'7"2 FJlP^S s/74U+*; 5-$5ЌMaU Zz0hZn'u%=ҚFաB.j mrNI# jtt_:ܡ!ݴwc; yMǫ뾃GK[Q>BToؾe u a\SMI)D^+0D- Ÿz2[$ݍoH"EHYQ.j.!s*UŠiw|Ty}d|.ϷIodv6! Xc M 0s6fIT[e/P+IAOjB.m4$]e }6MPalְ5╼ۈ[n~R.ӥsߟS W'g]e t_* |3bׅpf[}2nu([&k]9Y1B5W.uRKb0.](bOηnU`Viq02R~V &B;M)|ԥ rH ɺ K{".@f 7ֲheƕϐ۲'cŨZYmUF,8V湑ͱüM$Lw+BNs6+8X2cbg5L=mӝ9yæbrl31Yv- SŻ1ލIemէG EAYب0.ұ`O8[ K |`kjYnY{NS/d[O&gfY "_5A*QZv3Vʢ!Y`[nuC! INBdnt 2z6gp_΢Ŷj6\{͕g/?]LR85v%ˮ,$^q#{q\FSYx%c=]4 h5\!W%h"zftRI^E6 RPgMGYA-Ƞ UlRo)Eێ"x\_ KU+sɤ Dru3n3CQs4`4x<%C]-LE\kA^R$^& "o6J 8THB>D ~ `(.%tB<"ep%*.C !L kcWYO ;map7iQJ.MK2^6s/×nS0fPeG,-ӓX8gZڡ hރČ' V0[s80`2{ b lBMWj틛2멬_8]>#{(om]=Ӳ˙^!z=}͹Iu67pwbJ~{bxv-gbònO x֧|&odU5m*`x֜Ho<`mCDc d0&2lB,&&cx{TY\f̼&61ppYI+r,^@0]*Cj&өl:Zb4:ne:~K&# 64R쫼;uǖڿNMCjS F`4DO=dǘPg2ct5n;:gBjYpYG@#%PoQ$g4̟mصhY g2b5FY|m ܍3%܆<.-h&tu-lNR}/m nj_]'fUeb߲(A`CDN*5@ٜk+S2?:<#>9 PoۭzVFGM/E=Dh ':c(Jc2 #BNaImKih!kWZ AZ&]$1CGhZWNݧ2T::Sb<D 0@+i&%(٨UU8ixNCa% yap !8jm"4 ц;뭣y'$Qonb3µ+, +D2+Q-s_js"4v;h릇q HszPC66|>DuQ}Yy΋ s&v7߹+p @5ؗ = O4h WRRMVLPb lP*{9Qj`O]=\ |עԺSr9X3)g-Bu]RwJ^dta߰e/ R?RU7yr>짆ˋ) ŭm\j[N̉3 ByN׀(SJYaxʮD6ImVS g LKd 8;uCulWO[-; 7G3A|و2@&[Qa˵#Di{RͳoW Fg5pz={w-9[Yt6mv7}>TwBXٹ}0!j8M!@I2K4mu$ҭqB:ؤ8%LDzɬr8%E7V/;h>u/Q#u- ᣯBRJi5mdz:+̌DDKɂQ~/U.ӒYu$QBAr㷳rF7 ګi{qG"hRKP7'tP!lԉA Z.o j UgO4XEPR8UF+s)6:ƻ)I6[7U!bj|781888shɘR@ 'd>#Q*M<5]Ԋ%ްǑxpPJD:WThJ5m)ᔸG+"EnpvRכtP,4ƻ8Ri DjMV{ؒ&{g˅^+$D@[g>: ~;*}N{9w1Ng${x)=}Id(Q HRh~^z^ygڂ;zx,NtH8PUv\G2@B:2qp_s1\w<(b ȏ-2e(88h-cAmBBOBM.q`'F!XAD֩a%3b{-y;W0э4`b;rA26e{lq{O*$q+t`KmɕI \Q6 IQ %ϖ(m̂`E* b+%Dd ё@ (1Ah89zu:QT@ Ai1*1wsn Iǜ6T[6E wF _7vv7:'(ZlQ Z]a>i&n*rJZ/cEIiŜ=T1q[f/[H<_ZGrCO ke,+B(3 6qGITl i0aH߭ UѷH6 H n:nΊcqܝF~osb΂ Q@RAU7$u2&F2еRBB@$5JR N|H@AKƴiR5T/փ-g(Ϥ(E˻.XaϬXRH&tAQ*/=F;zXܜP$RF@Qvft.}qaY42PJrV8Z;Jy{ EaElvWf83u=wo}y>=|~Ǔݬ|^.{>?߽|߳g~~/7e?||~?z/~Ϡ! :~BI#tDF&VsjŠ^ B@q*!$$P)@\ @(B$HI!_8 +$ @ H(tCN?s|k@! e/O+A7_BJMN1ZECw]eBvPTtsxlyY6\2$ `hܙ:[3 ζ[3 i|1I :0E> ݦSss:1Yf[yve}/~!D  u UU+=%97.2tsiMmzq&j̠~M/'[ws_ 9z;҄:*AB H)?i(090Á§k›U<=w[z~V\tcs9@]x/0No/Xޑ4@DE-^C>)?79ݾ y~$<." (ͼxػ! _4 ˔$dP4vv8\a)lNPL88^ b8[<5._~ûq`I8`(#!xx>=̰: 8 J@ @ ɲ #@YW{O;[%Ah+<\Qւ:F4fBDP+ʸ$O{[TECq;lR2U kF_i\ Ut"Ӕ s2s6$62hogf] ipUm&̈́1e(EL"]#\2Y'8\ ںaLߵYttdNuTX=͙Nx@f QpgӔ*TJ{<e}h+!}]0T4dBn6\:ͨ "'4ĻLeUGx/*8s #5b@ dH T :k`t,WrkfR"mZ“H$֦4֍"k4nYNjfv`uv4F^U&CLʊ\DNt+p8貅m"P \,έ{kyW5 {m<#^d.N$_ȵu?d` }(p;Su+r-qظg$ "0  Dž" T@ 7K\!юeQmъ\YwY DڈL$ e )FS,Z@Nڶ0@Y8AoD8`L9c e>i_p2hΪQ(%&XY~[QR(jh 8@ l @ *k 7oSM7娰C%㦻@ۨ]nFVqx.Y~*V~&.uձuXp²A|B7l2 4F=;i%&<ͯa7Ba܎u#9q, aD6\i u7^cЪ XfM\qQF"0fQ,sko 9aAi;B^|zgt$z B 4.1%J#"$QCt=o~W1p֮8ᭉ[P+E)U|"k R LoTbBrJoV̪ 7>Yl.+]ͷ\ ׮V嬰cž>B&G8; sQYwzOsL]uVZ0 uBi_bSp !D”-/ʉXzݤTC&~Z, pӁb9nwV.+zL *7 |}`RXn>@ÊRu:(Y֢X.?Nڨ_k Ҁ!$T iD$An}Bc| ʆ7ͳ =^ [=&r.}@Q06($$$Bd$a@Zaj-ED/L'$sI|w$FN7FݴT P{8"S<3e" IBH?S `HKw~'P\Q$UȄ}"B1iGIIfntbٝ9DIv U'CI ${~Ʀ#A~suVmmNűmW¯Fk2myFII<iJE`qV)OgHN x LC@#w+8ۯKW'F]OPg.]!-A`_h SS?n玈_D9x3n=YL h!-GkGekDI_K?_ B2 ϥ>Foc _w C_7Rn tbvO$y( .a!O=?}Wř+>T} ԊY KP_wrO@aB9Tw-?.PANAuiu׹5 [{Ǟ {Ioy ^"ZL^zdDxoq0Gp.#~+v%=dY,BL|˜JkݹGڋi'ڹqYxkEW v8P"? ҭ& TPh$`$B@"$_CjEc#>ךyNv)Q.@Ci멦?Az= nw|; nwC-Sk[`M $!3=> T@wo#z/-Ar͍Vl3]b*%;?08U׿T@$$VOIB$H/o?vbKYYjɎM 뉲ȖG[[3'A^}.\,ǵiR\?z[C u>ە 2f$FaisI:{ܟGѦxzr_H_b0$a PP.iO[M0 >P!?.I# B#"2$ȱ! HCЕIEF!~g~O##:IeSGEm2G+Fg Y8-? cw)eyCx}flDGLl\-H&1Jq@۱KSelT7s,WŮe%# !$ B@ t_ivEÖvi H{sIwF[ ,C9=ӤGW9zwvWym#{n @C:*H`t-Ąa"Ȓ0G_GĹ6־͑nz)]2"@-JbS;gt["y"_=WI9qeV \E͋_hk]Bođ,͵ZïҾ5 5y-=D۵gPXn$|GOM~Ys[nӮipNI]nDal6VP9W\h/x56_p읱^o\_o@^&;f'~O-jOeg|QӹK7?m#sҙih!g|-U;ٷeSND@*7g~ڍ??V2X{J<*KGsz:~},=unSlb!3]F>SmwP=@,rq1 f^gyn6~T/ߏZkKRufQ߰hzkȽ+nM~8gˮNx:]M?DE~~&!ߴkm.$kŃj|Gr2Z񪬷ް!*Ts<DT"DEW$R@U=PU*"'UC`d(!qNV2Ѐ8/ 2T肈f*N Pؕ$$HBDԏD1'QG " . h*̤Q?FD!颻g Nk_kcaѬ*s =*'Ȃq` jTj&EΊq"t@4uinڃP";> )?,GC2OnFukZֲ"""#""""""""""""""""!mmmmmmmmmmmmmmmmcmmmmmmmmmmmmmmmmmmmުf[mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm`mm0mmmmmmm۪GͤPׂy(*"0DM(tTź3wBPkJG{Hn9Sr*D5&&F(3FC*(,G|@8G 4`Q$BGjU@tcTR6 -D@^' қpD׀⟹\ψrC}9]iFIFA ND@RLU h9 * FA8ȇ*@ܝ4wp7PÈ$As pb9b, F@rj!"Hm`뷵T`QwNTuD9A ͱtP$I7*ylI8PTgqlhE918PU3ˊl:R_G@UID9ي`kD:C֊AR%BNO B# Xoh""\CyT ȀȢ!$" do(Q$dAК2I^=RdPК1}t]mkM8 iETSR 8pφumf]ћ0 HN6)^) *bCՈq""EXTI T%^ bp̚D@@ų@f0 Xi,8l)# dpȠg/F jmRmE  /(rM؇"&tvQ+Z7@u0Ld$ ȲI!"H^'q$dTEźtد3& QP7%&!Aƈ(̒ ㊻WJ0A׀+qƔdok$)J9չNJ A,ǭ-p-Ql[e8@$^,^4QC, IAZ5Du!P@$$HH1 t&#r+͆BA ۉʙ:Gtl'_YCNf۫9M7^BE@+ǎ\;NPΆlxs,s{Y4:?gw"f+2 Es_ ,u HȀg*"BEa=oE5eb 3c "P$! aD@7p-Y$Cr-CRI:I$Fln!gYQs SoZ@dSf[͋H8 1A7y ˀчJ"jNG?cSV*kePF(I .3C}zrF0 HHrcЀjAug@xPJ:sZ#ƚ;(bdtuqs v:o)"ۑdžRlj(pyh.T1Qv.aǣ~)̺9sІdAu%7P H(Q8%PqȪ!t@9V'rjtnѾǫI\!BAyq3Kqd(|sr#LX2A.BqxsS-cXA!@Pjt82@C,PMކ[bcNf@*oTd$W\9mi)5iՄ娡z"$!ȅV̆԰]j1.S19b0 B@(AoNNIAT0FH$!f/;m[r|5QӇ <{s1NF47\"eARY)DՉCh;dD鹇U{8b¹(.,6ZJ@׎vZtg1 Dbv0f远r.Q 7;%X>=.-^_zotsf}jz}4cm\t ]Q[XBq2Y=ۺ*$&oր|ʹ!Tӷ6%3fp|Om' bh9*:pFv\_1DY5<"2P8 $1K+ KO^eX7L(0 ;q(v-n"18;]3^CQӧw 8md7QBDB& 6!Ř oⓆ`7@;Oytv`;%<\Y͡E;PJĀ@ԫ=㽦 #8@_4ҍ/dbѭ'ćV0E]j[H6(^h7m1q @fwtdpe޹sdgRh;#ҷz }dw\-}^PM8[=ETo)]Jms(@ 7ZB9Q"XMH$$2MM'O2,kժ, MS!JcFͅ[ 'ߒloSPrBLv2RUZp\K[Yl!9ܰrणl1B[Fݵ4eVFD m6zƦ j3KHz 2\2F+yI4 5w%x-+]T".2 <ͅE ʇmhsKR$BGXdffp-7(i(/ ~xzх7q…{ԔR9h,^R\\tӇgwcy2jG6tA6b)N!R0:hYҼ3D 8+^Ebҟ7 _47yddy|H aN lK$AhvΚ1!Y$%ܺSJLj5K8gLiUU2Pcl۹^12h`ǮLa6 7 ]1 ERy]f(Z ږ@ls!gJL3Q1{6o6YU)9RuD[gHm1kFdJ$ լdhF9% E E]2,-P HØpzHIn[#&Xbe3@f h@"ruV>p:Q{PvSw \ʋP/(! tfgi dW-L|1}=lI)!;F͜ o,O(}FIL`+N_P @pYC9"hC1PPBv(FP(g3|B5/IwIHH4 sBXf0Cu5c9!cn(<$ KAN,$ z3+΅0VՓU IfJMm&jf412 LQұ3R`]3lF3>ڸ p@o+}v7BʃDAQ ̈x I#Z5 8tP1Ae mqRY] 'z) Rpb"H H vqPu_u̓mS:[N꺾I\,gaԸ϶%f-P rg(%% e8vsL\շAɭAu131D3msfhYF b* {9Q,-:7K@N(;Uv`x'Rm`oh̺'uh< [/gE lhD-(TUʕ9_]yoӏa?m}B~bq*,P0}hgn)ƨ!rks(.ϲpt B$ wp '.UacnI P6.-/ ̗c x ZvhDGqbHZ&c4X hp{B{'mEIq&HDY,4m31:lY6A<(XEAd `%KpޫciXv]-p)5I&ȩ\r؄H8;f!.ع&VշT ub k@7k2ruw-(vp@so̓9FFk"Eɨdb YH _(WQ^ry%h]͘'(BLH_Ŝh` gQ ql5eѾjx[uB@۪VB/lj>#_N|w B M xMZE bD40QbM >:JTbeyx6H j/=il} ?sQF+X^q+f͏3u0R2wegR;VrKun}{ōk+;7u^ĩ65vL--{q̝ՂAI6׽Ư 橭PZ32_kSm?>ʷXMۥ8"G\4+۪l-T~ly *J L/1G7C@[b P5 H+TdS,2&*΃|^ˆ @_ @J6/2@ 7ԊP(dגZ* QF A*J w6au P&D)*)FmHHV]c RS&V]"%C**+C|I}I 2oD݊Pe"j@CKD)$V@2jWU AVQR( 1UD.g-#8V )m(2,qF0]WXe"URtHT| Q$EШC $D H' Zv]3K:9|Ocqa]BBY1;qhߵ==fS:{~SWuMMkt@8Ҿ  4"reRRQUR"T!+E ef-EFJ;Dch\TumЇAL&Sw5U-WUVCm`E߹JQ&:0oʃ˻~ˑ$ BEC̺\@tT*ZR |дR#kT-QNQH4bVم%bbxTv4 WQUH"P"E&G$0I1Q* %*EE ,Z-Ŗd)"xU@7H.d. _7Zd\%R] aD$ZMa(BMi*`l4!8E*z65du&) `*]e9J-TH.'7]R qmbP̤0(|(]u"OԀy@QC2,"f kԲ(@D&DTRAZQ DQQ% E^.RдFab#h10 F UHtMKNd]jL930 VT Y2s# B&HI!$BEQ* HdL@k 0tv vejm*H!( c`RI )&D`D+ŠڤD|}v&B,P/ `ӱ[NG% j+ ^ 8x𼏩.3c2J-I!%9j2 E )G#rLț,҅Je(])"P,gD+@ ӧzoEEJm4V%32HYbE7Q T6)kxYe Q.FA( bamP ![kKo̸6Q Y1u&'"b)H (emޙtKA5`x.) |Wa/}E;aXeK vDI$@hAY E* Wà!qZ!QI?M˰n3o40nCY.!H%(UVQ,LPkRBU]aRhRt)VJrm @%A 9*jIIIj!ZɋPWZTfe$nf@(ӵ:L S(!c**u\. APj|2(")|AP(\4kU$-XK  -IT(X :]z oW&37)F"b0q -"6jq TI1,V|Thkz+O /7@fU9Tz73>I6|-QdIBD7هvCq>$@nHM{['-m NprPԵAԟ85aJ3i('h!زX_BC#"d\Scs{ ˗nbSo"*؁@]133MƧqԛFK\]kH˝;5'ï1M#SG40dl>[Ë<ͫkӋVt Hv]8t{)x;g{af|QXϻVlյ ǽZ 9Va.~Zd bky9y'pS;mQQw3&*y]>nmvl}$83,4"9=/.o@rK⺵iӱ*(e|5 p:7jG;^ vŨ^z`_Xq5*Z<8WQr Aw›ru>3Np;]Wv9bY'瞼“+fǔ7 2i̸`S{zO-3Py5s!7 0.)WO>X.m++4vT|9*t\Lh/]@YcxvR֖{/jMJH0B D `͔8T[{9˪oWdq5J!ITFJ`Y${_m>򠮼έ~_&Df7Lmޗ_Ƌ^]= >]/w{ ׮z Q 9l w%wF"l:_s&1 .6gץ1Ƒ>?`"` ,;KG]&C77$rjxpH{ZͮS'M0BJJ)R:+3òkhE Vq-FURݑd%}'}zdP߈۪H$oDmgWoéSkBuS":oʟL%aޭ"m/8<A 0t$e|t D]H'N[NJAD`Yyx3sBY[/(c/3cTjp"#l] F3t,I A+B!"aBu̻ h] 2~b9#B?'/^Hnɣ i) f 25 F2D )`@Q /YgP q1=vmY AM$or͞Ed4k:MO[hq2@!DDǢkIEfs7׆@Ī ).2cbj0EZ߻X*qL:DzN9c$g96&'}{{`9ա SeC׌IA u+ihG-7ʓ:6#j`S"4ۚ{|"됁WR˚R/!"VBM;1IlЄ B VìW/FЄ!ɖ/zĦoOJ 7UXD`>perVщ@E|ɡڿܘ V2\heU$% Ƶg1):BD4A8sf]}zPz\zm֬֬2KSҼl l_!Sb0eMxv׭qRq- v;Je B>,@0͡(cuWH莛݋lqa>K_'o<.id||kJ?->„7||{KZ9]VJ ,#UD d/hcBʆ!q'Ѱ:*dhJ̶]` mRT]ujϕEt<%]LGF{!y6ʟC`zœ[m=e.g62]elݝ}@n!G)4 Ѥ/ @DCm'Sh+DS,Ř{jI'sg_l˙x/לirA2#6fn{%K)`7l@"d(,1r&n;öᩅwT3 L*:706{iHh*,&ʚ24k?Ns6qهnTA*8+p 7HC 0|`!vd ߹w""HR܍l!e`%DQ_I *jKXcSGku# 7BpgՋ2w%3&Bu_"Sj8@ma^=4bDt!8u>B(#M >_#hSYtG /~* y@"uE< H=v/G]SJ>CLL6{֍`30k+Y"s]h5w Hb&2)Rj^IjjN8[݋ІfkP dIv{H=S[4;ū]ՓkUp15e\jQUe\=ڳ- J(bR)q|2Ȧ0`l5/y&k-}08-Q9Gg^.! DsS~&0JzՌnj_>z_=.ӄjmc boXŠ``o¦WrտsHWz(ֿUxD=ZqVpݾUr7ָ - w^wpgsEAؔB ae.C,f\) ^UӶ)-ݽEË7ZK]p@_Rtj{eu/ .bhVeN ".=ay(}ձ|K;kAs H3ܶ,Zբ)9n}M]Y k1d*V鬿,[@6-Z%I:7(_:* V:e fC"/Oe'u) xlf+Uժͥ@vv]֞Vlco*w{ اOi@)lEץn2N߫^ dMVz&K4hЀc57qk^S*:;2Y)Ωz oFՀ0NI@}IjuY-h¯k FxBQ tfoa mjfѣXX>ԊK'|A壼I=*^cGnz "&j ౖe=lث}$^RʈQ.I7p9)¶H$ڬ&l=-eά%0Q$R(^emi}p32LWW&*]ŲʷiW|%'3 _,:+!s5rOɻ\XDxwU3w$O'!+}4j*gܖۿǽ;XB|XW+l"tvLb-`0Lje]SrS[vј lek4^o"}BmBZ8OqL;qꛇ,EWQd=NEo5NJJe|t\4vNEեvւ'rs4^ͽ 3;o$5YB+6NM拖enJZ>Ix)Kj;淲œp .,j*SAsg SA۫R\ݔ$tAM-`.&PXeXۈSX軬l1fJhݍ~kzЯgȿ+-m0Bđ,)xsP&6 Uy]P* VygK [x#Vd^L8*!vJ.֞RFBLUon.W ʤ Qh~SK(S H0Y&E¬[m(\a)ڔ8xyNg5kR56C9P*e6~mV^h43/0V?=ilOtJܶ?kŸ#Zxm2B\sll# `Mƛ&1J?Ҭ2*j[ n8J1ҾwWK8RfXsCp Mo"])" A҈!;"Py>񧃣VnlrSq^m$+4$< v86JDD@v$(g]h$E/~ITMr q-ޑsh" @88Ki|OL p'֟vK:BxA&̌:avpqP r ŹVIJZ 3 ˸j̑Wȉ+`S!sJ_ ;X(%j~bS'QG BEw]e޽pma^%=(܎ILȰ3bk3]F'a05}JK{++Bʳ7 =d&Q$8Ji*pUOϏu;Tk}hD[Ih,BJʗ!VWdF ?l.-v*W-jp1W|YRW|d89ܣ_'wRe]9#g0tdtJ-2!#F+HNr:sy.r~|^X9.Gxo[IB6Z1 OZ_$NfvBWP8p mrq |.:1}236|]Ɏe̲~93),\cR@8~W=n\D!ު/$DR6$e]E85*I#t6M?9ϕrƱ./ͩr7ZZ6]j:|^> xmYC׫|HLZmFDQ`Ii}ojYg0t^^J9g_ ,t29|gr{c4\^>Z_:IN+? Ь)@xJ>WGPi GwH"F?}޿\reK$Dxv+/Ǹ @ i%&\}z?oScp>3MxT%͸}Tf6H}?Xߚ$8p ůgMʈ< { s5Vj[>< u,ZDe(:{Ƅc@@s( 8ÙDbu Y~V.\!f7k 3T'~|{/|yWk{,="KdWX{) NY=4wOhZo>J+χBs2QUxv[G_jx-bu0p0 ;o~[uzy#gJ P=QD@3':z,~#t~G޾A$k}Wz4ݴ; ]j\/ _c:5\9|^N,Ea<}pۻnw r];MYz= 鿽;cXgό:T?eg{כy-7uj^x bŞq1o6n{5t?6yzz,9܌HMй o ${w=FxyOǏ*nOvZ/vyڋsE':%xi}omor'UݔUnI0ޮH,a!=%OdC ,QŃ5݃V:_=o )0w> Q80BD"y> b0Q܀*EGFDC2D@}EץEOQ9@WtP@L WZ EPq xAADORO"rʀ #tTj"(}TjPxۀ'. 8"'pw=fyթ@ "a~ E/^zQL}x,W3J7LEU?CSxC""?ɤWb@DW,Pt$H tD̈ *_;(8`# Q@ D?r Z AT{xC`@2D 7dDtDR*w( ;p؊h"tS6nntC,PF#-tN> a(P*⫷W*q )]@!>{ٲD0Qv(-b{Iu|aA?7 }Xߧ쀭WzPSus:*a 7 + 8EMȊ.X"$QCfRJ"@UJܺ-oDIY_*H[EIRE\@*(R"/y?cr?ܢI>ۻ" UO堩UPQUO)E%;!vչ./&Q̾Cm{?ld m~e9_:'X|Z< Eo?QS!EPϯ \}7+e_%wuCJ+ZPeQ~d~)pe͟eBA8Em5'jrGHO~j^cQsxx_ݢ{JK? -+?6 ;ߚ"HG#rH}Yti6xM[uRMx  o4K׹y_k `h??уp$]_kxxy>7'&uf[+)U+R:_ʈCAmYȾWTвD e rJ^[s-xRWUHw]y`ĕIbĢꗰc!UXo]Wp}:R`lau|p)E3uF 4JT-"HbQO-7G z]OC"a~"ig?lLқ%k'k/=<ͺp~z]zx]֯?qszYx .YrdSֿ SQ5TuOAp?/.Ҷf~l}fEEc,8bJq^_^q77m.~yϹK_|lO'Pl~g.aTRwߩvOxlA5)-?~S?/~o'7i^TgO禡Kۮ٧ Y}='3B/DrC<\!AJ@QwpP-1ȈZ-7 Ỳ(( #hA*({ҁ |P / h>fu0@6;D@GD~tUDтmoa=P7²%5Dɿֵ0kƤvYg"›"繴Nvb0+?85`Xb#{HTECdh8"P_g*S_p'f@}db"*A#ϊAuh"YͥzAP @X/?=ϕ~9ʹ #?AAO|r~'~g| łW@oWA] $D/XD@. rD(PG?Әi pD X@9hD,]>QcV}fu*E"wFva LƍI>#id|'_- }~>|4(=d9 =@gQy˿ߍ3^G Gl^j:}ۗ3ohڨT Ѕ]`FVD N jE] (9ԥ]^LU3{.W1(1'qo9 ^m9@KMFShq|ôt$!~ڍ+wL`X\||onbbgo8! N_B;(T* "D$E %.XZK"H*ȡhHT͂A^2Am͝o?o!@W?(U vߚcOǮ(l-@A8E<ς(rmE 6"  }KH듽G?i{>|>wɓ8^W&6F/Î^6XMMʽ=~ɉIXyIhTлFYiՕuJ/mg[~RAR[OlzJ97MS7/BոDZ硎( ` U0p\w/)M (yX_<i%.sR(&Tay$+k~ %w W;GIo"^,X|{fNf=It)G_B ހ?i0# իiwJ󶋤g}Nvg^9v{' Q4))jdT^Pׅwa1; RTI\'{=ͳ3XI3##8Ii Rh# =tA smbA&ϛZkm,}z̭W2{m>w'kDxYU NԐ0 wPd| HYᥞxi8SG#"sSD'B@G^\ENR? '_OUrom_.\jF Zc说u?vvC@۪Phێ Y+UyQqOmS߻ e?#Q‡ ˾S=zWLj ˋr22@|Ot"Y04+O`,n/=2ez?sl3(\t0B qTBR!t. YHz L }̒(73nn ZHzSCH`*mϦxd9>'k__4[u ~0aJĺem0\)T $G6Ou<& Iϡ$SnYCJ}T=aʀmGzd\J`c/AEC:F|_ȳѻ( Ա [SC!/|dOA1hL\[B_ǀtP/Fh_x1G1v-V;Ix"q]$eLo87((QE0OGAb(z8#vBO;Y4&iiiYf)f@} |+aO$I$^0(,f|(x(~QFRDzmxEQEDE0RBcמiM4MSK,1/NzEo#ǸҒI$Mьia&ϑ$I$ I$qR"/06;_gʒg$tU|7SEV|m),kTf;ף/g|]{Ͽ䱈B8 5?GߞHDR}L nE7O%NʃAa8 "pr0 #b{eEhmw]ӉٰHVVȣ /zQBr#zoП qga$@59[xx(*Y/}jPd2߆eD"TgP<0=]ԇژG˪R3:}ZP4 a`C`4F^&Wu*S^͝Z[D9=FgW\Sm5?kةD3^ō5 xXvPpı܈ re?SDÊ %?'|.Xqn訯f[ԟݖnWM?f*{]|E5{`*Ts|oOM%oK42h '@!jO M@|o!+L3'e2EW7Dh3&;T`v젠Pݍs]%IG=`{Xwq!.;s?j}$Iр⺦Ʃb<2~s*'4M?r6K]Hn,1qK˧h+1Zԫ^ B{~mEkT®`ղ.zRq6V, R )Q4HCu~ C@p ;ePvQv›g.߷18U~-0<V϶ C6۔Oz*(uF/CRg:m[K "SW 9u9#lw}Qm )GV( BIܧ 8 k"31*?9Y(r8m5R5T[u\η_y}Q ,-/LyvozeVˍyCu)[$.hl(`7$U8=vΙPL*> pA 1@R.%lo~ tC {E2}5_J 4`CMĒTX<஭Dxc eũuwUWobS[ǜubvuXl"LdJ'd2oB{ʌ›'ud|W5(oLq~jk.@`:sE?J5/ٗ~ϩw>g.&^Px!׼1~ wv-G6 dnQ0]p Lf܇bIژ@e)]|6*-T'۬ur£ _IQFȏM>V{2yzmTgRP?D #몍>Tt$;=%~}XB@_.a'  0Cإ{+?} N#'^{Eu 13Kxwzo6ڇƉE|&z`+rpZ~oZOҦ58 ,[BL~=,ܯ4ۖSj 0N_W_PwD>w~#ٟ͡mQ]:* i1/_?>}2@,5}4@t15L |;8 %nkj}1urm^~'7`#AeFicA⨑3ȸԗN?['_r'[^n8|CG'2Rb'T@Qp͸Xېk`eÇ^aTGtqUvs M_G!(N*NS4Iۍvnj2:} m SÖo'٭ @(Cp4 r晥^XEbfcF 2! ]Gðsgm4&jiB n3ו&i]PdcqWۅFx̀uZKukCr8_e '|y,/f5BH:U 55 { pW u礡uN\tXiQk5  + % TJiўig.vw䯘J ˕_a@L<TΩY;=L^O}cq7| xW-0|MF쭎&Ar7/9W՗x UFQ+8eYrw DVR2m,YKL(Vv0\D ұ6n☌o܈c:SA8Pj*[)*DIUB*K*JlgW}seP*ictOɒ+]58n.NZ d&$ (&c(t* Nd%{+t8Kvh&:'M;s}%%mƼ#b"tm\)^6gCuaMst*{][ ?E}f]LT+ N-htu;^^=rik_c C]Z%Ph) Ync*r@- S2e6:O12O:I 8=];9I1]f]:?L9m)lDn#6؟a˜^H5dX#o4o\_Mh@K9UfQ3nt \hjNƮ닳2`gUU"܉R+G\ŰLByjzplPmDV!/}_;sCn!y$5Ql[[7ADFyj!tUdWct d[P`]i$R $c! ~L#1nS#8R]b!x/ﶖK,ɚ_H[> ow A"H!$Y!8űE+BaBPqJ3K]"B-TN3IZRGKîfŖT>āh{/KyEgXp ^H" E#FFd " ʂTUP$^j$%LH£ H@dE$ "LȘ$Ij("Em-@TI| ظ " ['ޟ" f<}f\ ACMqp7L)[r|w+Ȃ$ŬT$"H,4^.돃^M; M>YT!B$1$Hc8y )ۅgoѵ x=KN "W,\\sHxɏDVRƊ=Iϵt\[ lu'%n'}.z왜-y|N"[g/C p}qD  iPRaY,D?ʨؾx ,^'N, Ogr7S:) ?GZKBPOȈipi^ VӲ]D Tq/&eVp's;{?3)-nn)Z`7~2{NP|vogs``}?Mgu ''[<p^|P[⍣;?h5<5S$<)Q# $Fw(hͨ ѣBH'%pxsKR]0+5'u8\B$TTJЖjK.=)pV M>Wwi$Vq_1~ @iHp$@:pvl:{ `k殑w RBeDbgxe hM(6 sտn=SVL'{XGC5e REq&azZ[B")#ء$o#ېT{گR:Y.nG:-U{lJ_¶ߒST3Ju:O^k]{My//qGez%F~[LJ;ssþ_QgQFmrm؛_UK$ T 7K@E|*H `&n|[$%A=m"f ;@t3( ~ P&柍C D|2d'-?咽@1X'EpY#m[\/<:4&_%|uݣCpDHU8]R+YBO6@}O⺉U +WUaYL0SzE{E+N¹YW9Ƥ%{<5`0O呄!; .8t-^Lh] uV+ߥ>Z<b>i[}BQDX@P:#5 rQ~vWnEc`VQ nGhN\f<NpJjDwZEI{!* -(NEu))}+7vդX( L&eFnkۃPH@$r5BboU6S4~KҴIuO;|BAccX-'?;{SĀ]tzn|-ܫ/CXO81~Ocs|tيqD/HI30p@4iQ v~틊|$+5삞jٞ"*\jz_KE@$dRD0>aan.1?,wh6}ެ4BHږG&Vm1t77ysk sn /z؆b562^=;ISGA AJ B ?J$w3*~[cxxx@J9w܇Im9pGMs`JZ7&w@4~m\Bc%fײz4p,Lg/oړVY>e~SFVư@%o8։RDQI) _e$O}{jʣ~(l-}vv#c#@fRm%do0J,˶?}AovY^7Į+_ ~Һ i%QXfL?iWZffAMl}`Owňf^ef 7EA !tD2hOk3k_=_r)N;;ԓNKozX4Lɂ\8)jMGmώ[z">]X2Td(.$(]@Fx<ί[72q դxK.z 3O%w xx8p ~kV~vi* ==AM+N/C˼a |PgA^bW!II Tj>uj.zH.܊η`zkDS.=]m,UasaS4ŲP|gm y@$4XT*"ab}]dS}8lɚ1Τ:)ؕN/^7fn/Sا(((O;"Hڨ:]+=ͽ< rm_^E#D\BZ^%Fe8lg.BQxV7gbbHk@^_M@[!sKS6}ـthFQI%k:҆)WPJدϩSuu؏=TWfLm^p͖/x{ȁA{8p\palSqҐO&|6B؏fq[uzY04aҢj=iK͏s>^x|"BP60yFʠ}ӛ鈕D~m}Wr) TdI$@YBAP$Ă!H !LqHR!_kYc[0,>앾;|o|H$O8ܫ7e;#J54O qHQDT 塂ĪT)^,y  `p{XQ/oGOKw75Zwķ1[K|aXkMTd$$g_LezE*Z㷳s" P1ζ RWp2t@{)}mVgl`!A UE7]0zf5_9Я'A-Hpp<'\|~U臂-j:YDp'7|߯tl=t)sbN=$XF 1wީ%LDRCIa!/ず/=Ki (a.ȑ28oxjm˰!j}:b BDrKX~u0K)H4%FeaBKMLn}UY 6J( $!-0VGzRCJiFuM"u^#5Lʎgi{ l /JX(mLmCM"vqغ^^;Qno-?_5z_ $A}A(Em%w(=G2x7]r)Ҡ]cJ HbQLW k&knvĆIӏˠ >y;m Fܖn9zv{{R[жTT @DiI-ԱW(HƳhnJ:oh7!.&sN O 0VW?DŽwH_}8l62kR:{CZwwp>WY/9]xږpQ2 D q>4x[%iOƥ N7(G-aOd[g8G]OK)PtAnO_)01=~3cQ@-jxbF#TyLVM/$ C4YU`Ժ \M3P+ȏ >{ly?r:M]=Dw:+sSrh{MqaV:9jսJ?AIЧ8Ws}vafsrjۀ"@ds, HB1a~t-C:H.I_'6pe OkB]0 D%=S}cDǩh'L@*|?v.y?-~ά{ ". H0t8I8v-bbNtb}ը b~C 9]]E~w.~o-t2}Ǘ3?1< 0]x؃| O?ˮNbڙ؇W/q@8~DA{~տa'7NZbaDe{00²KTSƕnU8g~ڇ:nwݾn22f~QnŢ95o]&~ rqD|MЩĢAFrT@CcEbﺷ;<O_~p퓕@L .a'!I aE@ʝ$ !,H7O_E#zd iW҇eiymO)Ux"&+i ,O[6/#ɱko+8Ӭ>5|a Jܾf91EObK_aboߍ2h"(UJAT$H|hBDaGwVG!~_:U;htHx0m[//2[JMy %/h#08RE2#3#8fYhm0]}zDo(<*~]Yuz2k_z̖:֐ ,̖Ɖx}z"tas4i?c u )R ?^lh$;r`s&<iWl Ɖi Vy\C2 }vr!@{O sa֋W=1.e@cAsUtV(gՙԇ͔`99Eq9 :s g)" VղP> DBuJ݌11ѿG/vxxN/ǻ|.cí/L)[6  X_eb(}0#w-tEDPKqؠzIi3g/5L).$I TЂF'ayNҜ4S (J(@  'f\*EٙkUF~y K0eK71>F9ѢcM^Cו"`H8m!np-趺A&ZEN tuf/Uq~mGzt("U;*gJ6W1SsjsK\V)yQ0tg>`ׂUm9Ae/֦ aJH>e JiL4a0QYC+QP~Bwk gc~B#iQCWM0.s{VWW.g@0fg +Ty [HF;^6gݯ嶭 qs%u5og]Wa*OݸPʒO>H([ʶ?*6 MD0 %PST7iDć bmҠYM) ^#X,i1\)LJ&X$t-TB2FHPO WZZxB_Ug(F~,QBK"D 9avb? DC^ CHAB B ds.K-ZȝgB M)HХ'ڥC@sk ävlKL4bB9NqUs^KË*ߢI#FIA IJ2TOZw+8@7uOeS1@1V:neN'JN*#ήm ]T43=8E@e[<^$z8'v_fSY܃jΐ <8E o +SRĭ #^$ٸ'biPvYI0[l r0#0;*Glml~xYykUblLE @L =PhƆKG@+y8W{x3;LUTbh)ϾӍ9E/-ʬbeyg$Ÿ.뢌z*o&/6Yr'FX Pv)٬Ol_fljϤmU,|ZcrQP^"/Y;0ype7XQ9l8x$9q"`ص!W?lIνo PmwETVnƖqjYl:zzU,L_)l-|޳|ӥ޶BŎ:LK%)9N?2}eX4 )e$%EUrcE. ? r1՚sPRixQ[0 .t.Nҋ-i7xK?IJ@es]K+Wvԧ-vQkF߹lD>$y+U`Ք۩Jd_ԇӡ=*MgaBm 2+ +R1J+ t 06Z[ʪ^\BMWwK٪2rq vUA ],7:LU,Z t(B(h^\I|p@"P7?Gl? pW08$.:6@ 2S^|VJڕ׻Es^9-rp! د_w KVh() 3$1*21fƑ.bS#;+7gS>WŕE7` =BNk(X׀u\-0B ~oaz:ڡjI{Ѷ>1!1n# K"\oM- |R?c8x25"-I}TW֔ '7$=AG^" >-%z#~O3j_'lh.]qAtUex&XQuE"%"b"Nz6z/Xz8Ҁ>s)I4/yg; t^}~Ij9/N#Ҟ7{z3IGמ-4LdJPXNUuW FZ 4mZ #<<=j Q5 Vp`]hKD \q0 rgY;p"'R2 Z1' 09ݖ+F(XŞnˊ&tS`Tk|\y~=6~Ctmq-;@ @m+3;D@$ *JH|Rgȡu'(&և :t 6bLAS> <8qu~J3* !uzOwB6 -/CҤXSuB u0_# C>" qS"aךWQ|Gr!`U4[\ղs̎ͧFSU`01%p=''a6{E]hC[[7ОAFH7 C$C%B[`Y-:m%{!WwQNvd{kLH&syb87@]vDzʐ*UNm 3/׮>rF}5c |ϝ7} jKD.IpjTgH)WH_8Mb !@EFf~~k?akmFfk&wTo|Շ|T_K>?X5zZyYIX߾ϡtf [YIkϫo@㏱! t$Oe2]I妍 phu?; |])@6 ^PpK_FgJq,RTN El($ $l5{>jiU%!k\>Pz_ku`u zF^ER)=tqnn 3|%7le̬l0I}̭MGdn>ߟTS BH8rMvҀov'B]N*[nrP jmn 󺀃mDi<FUc<:sԇSu 7f8=V8"eSM2CP {Mw{ؠϙ*'降 @ʪ?ֲrQ{?{YAz:xjm!9ܶdj?mY)_o%^:'}z+mR!X% dw蹴Ata\O:u'LꜺNj0jm(aR &MMIE8ȣ-ߚASae}^z/\YZkc=2|紭ԌlZ,{ڝzs9p>;oNj7нwGIjSpx B$nZG:S TRXU"HnO[j.2Įmyruv%%麙_A1B(cn12Ej BIتIĨ \$DE-?f {A׮9N{Y`EWKfR2C$# ]Ngjk)ksy%5 IYf*2Pkt0n77 }M 7Z'd_y<4Ȇχin\i~ʚvVJ'kzf 7. کLi_wa03h5y\y?]v_⧻&h`>3hM΄EQaWaJ֑ ٱJ?ʊag|:_ʷ>t,{ Z ?NU)s4xnWCp50eW0@_.&՗$v{EK4H՗ȴG,~ wq=A5*qke/bΟIT--mx)1xKs4MkʗQxnonςfo1\?>}UEJEa"! y!~/D>93x^G?gՄo f @?O %u85۰YT`9BBVWMŝ8%@s&%uXGj"b?|rJòZJCǕH'AqW6͜bޚ Js F*mdk@¼pjʥl)J*>+ε7p_ sYq=׿˜}jtH]Sوj s 746R]@XQ[< Wl6Ѽb)A,\xd4l4ª]Tg=nm| SDHr&qnZX7:$Q@XzwꚄx0!KIGAJyQ7z/t Ď3%=Ry m񪵙MҍKvkwv["9R5@:IgSb 3BXPxlsZ{NE]䫋TNT ױEǚDcq DC] fANEr׌L7o⩣˦V=6GEɫ:vyXrvV F M 6({_%@4 c˫%ꬅWWQ*e#!WJ+{ESOyE%/B[TozV73) Q$I dXRעKE0EH4ik$#\w`^ FП8yV J\_6[;|Ou_}k7m3*1 ^rl:{f_z.)sG^v@ie(ada9C͉ɏ@(E32y'{ij_ nQI]&szlN,U"UzeM"I- WmH;m"DJW~_{0q>߯?>_*D(Ps+cg޿ܜsmi"l&~h AiBud !!y# /$$$݅@+f)úBJP!?ꂒp0E(?|0$*5 $bQI"wȬ7˒GLiB0xwZC": @|ǵ$b!ݝ!*{]+H/c;oާ&! `I H@?& c/. hq介9 ֙b gbІIe %BBDEkJUG+ሉ^ŕ T5'qf2@@(;F/[5Xv #׼;3bցa48~#T7-YH$:rN| GU>zoD򤁳riA3r\l)O߃w]/?d-l< emTbWD+E{'=xG[N4w/KPci=L/vz?6Qwb8ڗ??C54\&Q8^O^KyX!jOb3tQ"Ih8pUPFVQ=f̽+݌T}(@}Oi*.ܭ<~{ rŭ6WQ H_I?ޯRgpp |,g_JHWK Ӫ@/67\,Gzoi* Wg3grJj^T~NHg3*iS]/H^~N|żOp 0/)**e҇4ar/cPG KH'1pW7A&Q4ԑCI!bOO~{d2_}[L'YշȤs-4UJ2uԷ{L;pXc1$sr p$HoH"'9RL&f&ԇ:/Բq?esCMvT:ݙO&3-vWGo^e 3ŋ5#{=np"y,;j KZ,HqջFC}\yH]|Ew}m+ކt:\TPF>Še6(ܼvyL[|F!/0]_y(Kkgp{T@^%zLx?Ktr=Nsp>;N >7 M >ƌn9PF@/(i_,Ve~ȈБI+h 9@W!HUz:KJsqr# 1A{@w򊍛=vs!oVlM"wZ(u=zKMy@ PyOr haIg- |F}]tDT@(&R] @3x}PkDȔ"g/X=}읏w0l-ě ϧǯMD !+SrY=*~]}g'3o-҆q C3g0!4 t, =.oSGب\(svDCLZ$XdVlȢ7'[+ <b䯤y,dwI ꂲA ,`ko)nm紥nV#D_1_ku+XSm|ZW3cq:6R<=@[1ii`e0ϏJ8|]+QQGY.Mj+ab jZ( r>c+yƍϜ˛psNVDGfZY٘w[{K(F [,YmH,x˕5 x$ʼP w\ ]%[]DnʩxOVӶIXŬzMQLUTl뜊Hg}!СKG,1C $!V%&\6~;jW~ o ܮ'ג[\HVJBҲ0 1B+DgK7F7;4JKmTׅn *آHB;4s PNTW\K|_%Z3{5Gi; GGw!ϬzI?GGkGͨTnqF<_f[ _7@׵<g}t82"=y&ݓ'ȷ!񠃾Qa%{׍ܤ7)+/✽5p_o+3g`P`u)OrHQz\ޖ*2T`jA݅ilPi$YIl`LeHDpiGk6, F3_k`Uz6`Lȯ$%Ed 0!8q d,N$woS,9,܍N/]q׬6@ WܒʼnoHDq@RA3f4S&dC@@4s۰`u, ІH"n$0qZzP| ]L%AX(H4V3Cx}Fcݟ4^\Bnr ?R.?@ sSn- 62/3wk7D0$A" [0ahDp$ r_F. Ďp_ ` kdEkm#W^V%ot`1: Oep@ ţaP?lfooL,a;[Bgˡү_/.t㌎t Qoab DA3wlW*(aQuO<^4sK+x^}fR>x[+Skv&[^XIpQѦZYX@{Uqg1'JÜ? y3|.$ 9iF%JnjoYRB@ ֥|N 'HDnUE4r(wJU"MP $$D 4tkySUڍJ˃&+!<-"4sZBcfXڞ%T PF^cxgd{TyNl$Pq.ٺ-* pVڵ"H^5}/c.=2Y!wV~;S,uZt<ZC}١;gK[\Ӄp400jpPOro,:3\ =w5it{| ,2 BìH- k;'FP,FkwdQe0{\_q(ek/֛|])|h~EqֻkiN5J>,܉>q("X(L%qG*Aԋb>ܳh-} NG}HWEɺj!KY}\A`в rt=ák5SGC##a(d{V ô}sYqFہ2/끫A.\П-ۆ׿$ݦS]v*2ĀR Wj .Uӝu ؗ+!ֵ}zi‚XEJ5Pe~Fd<;͸.q-7Sj猐us(=FY˭iH~3A:HasFKHYqM[M &f- *U,D?5n1ŮԿŲ(zʤ,l!YjK-D_It*ɨ3ԁ L.e~s0>̈|446L !gmUGؘVvBфը wj-Y؃vȿabۣ~a(l2Ûp*k4#UFo{xe]LpÂp4v_LHBO'cKu p3qŜ3 [o@5pKK'11C֓M0)q4/Gqu% ר~H*JG}M.ƔڙI(-6,S; B Z6׃üY\%s [:޴+_bZzH$#2@ f RT.lPPv3W]vAP$Yܐrei׮||ު֛11ƥ${7Vl.oUz"tUZy(%;X۫J 3)`+2$s߱{+I4_:arip,Kxn򨎧=9ws4rCcS%ihhPe ˋQVM,䖘  6ż ~M* uEc?#ЀK5\$0r@9Fϔ00δ"koc=eO]f(!tЅ`ߠM},]noe~1dbQ( Ajf$z F,JR%*U+c-ڗ;LnnoNtɲҗYQZtV0:wدphO[7w_W"C3\PȤA*AB@!C? @Kh@.=Æ @!_C*2bD(biR"fh#P@-J bq^6VN<|2l1drƈjQbK`! Co/MձIƸR.0IQ) f>27C$e%j_N_s?'$6ݼȡü:L]Oj9M5 ?RN^fhjRk= 0/#6P;aO}s0_nf '?pujemJ$~ɲ-ʁq o ^h0EB ƜQ |(JN2&#'"crl,k-V߇f\"xÖ=]v6'89 hC VaPx^UX7idyl@ +0|X).8+f/:y4:9g" 8g5'gay_Rg=l"RomTeI-TϾYK#+D F5t-G BG@(2/ս֖xGH9PvY_kม)ƀϻ.mqW~_OspeipOUZk)U8u P$mȆc"a! ;FV=LNw5ωclΌQ}GCļܫX)ʟۼz\4uv9jr5 $(LHAb3wČ! (Kx 2K.OYd;Mzs֖V# /~wy<3>p7,UJyE[e"!{)T+ŤR4w|vq5ٱv,zwn Q,-Gee{ZҕzTmom;p`O2@҅0 (U:{/ګ*mߵA)n`楢WW{mRޞZ >l0:4+Tƽ6_}?[{a{?5ORZ@*MH~_]_ݽ(k`H ^ը{MEa !j>u=?7@.#pC"[2%ȣBe^ t{tBlG;E/p-vяȼ NX_)Q*aMZGnÆ'MEHfT&AtfP$!@*1e-  FG E׽xy=g1Wm_@KhlV@'DL5 4Wk}0nUt U5san_LPe'tS4 }Y Ѧ(NE$fݢ/!fo>5C}ȌUEMWҺ֖|n1~)IИOYXFNVs~/H3uۦӖ a@9r7&K.{mR5u.7T0~?„0?u"Ŀϩ0B! Ξw3t]Y~gO4[7 VE{wޒII5f1 \D%EdQM[ a\]]^fS"q>ҟL1ٝ!clBlE̬vGʨ7(n( u1d;rG /k{fʌaf05M6 93ĜSiV`͆ENpTR0aj ζG5 ϐj3i]DI D5ΊfۗgA #w8ZnM `|3 t PN"bN`gT@P1-E5 ^~7WbCi V*Y*<##KҞEqlIខJ-.EWm#D%DB̰"ojJ>Y ;: [cܮv咵CH$LebdKdNNBB4ac맫j]n8XrxZ( ފV(67m~U/|J%]`}\9zL\VuUx8(EqM3:qe(`wZ;f^?vhaӦt\h` ߚhZ"j|K23G` : %@ws2'u! yhl*b^K:D @t3X{: X| 1c{ې454:ngoq 6sI?<ۻ:{RO䦐3{k~dxYsq_wqQ'^AH#aec~߱o5֧AMJ;jke탍m#Ig2c'tӵ_^=G=rnn t'cMPm^!x 'C"Xx}q+JXV~kӫI 8 c. c8Qg:B\mGFTeyUP L[[̌HS֊.т"17~[ߛjCj5$dn5Ed(j$@qc4\guzL͗#au]6M6l cFbŽ(k/qzmοoONG89-7/An}o?3_rt6s;f*G7p@ >j`$I&(m ]OϫI(`Ҙ\w(ʥa'O mQRxm†..O7F|J;H3J@l6SS+sd W䳚QJn?-iql$-iۘ @l'ong-Ƒh\c1J:^w~/ku?G^8 5o0aa(j3 n~S#,֟7c:LE_1[K: ൕw۷dq j$ $?F $'B" Dۂ#$d]uvr߯:yKk7ّVI"82p4/ѼWeu`BMzN#eH9[HS( W >ٲ^]TȆDr$Bf8;>1Cιzt;{;}A~I.\߱ĸRG" @ B@$um bcI F@d PֶJjҺЉz0oBU>l$P!3LD">\I_߯eM.5&ϓsD0\}UbG0 +K#ѓg9}z_o6kx%ƍGa9?Wܮcw*HQ|( D.or.) R H9ŵrrǓ;'fu+Y_{꽾Mץ"M BH@p"v( 8{-: +E""gڮKNa*_K}C|;*[k! jR] #$P=-2Ԑ@ H*%PBI!$R@ddw>XpO˹% Sfc0b/T\Ky̬U4&&!I'Zk2l HBmG_ iieuoAB0H>6hf\kTt|q`ט[/q&Zn_;o+${xgwrxS@ [~5̓kDMq F%bm 8#!q e_V|_ #G>(zΆЀSz V,6%i );ӵ=QA"؄(j;iZ{WU QH!4ȼ~;Ȯ]sUX(շgFL\hz _`mwCĮF2G+w8͢HInhL>Ỳ!cј2BhV+B^Fjb@A?n[e% ?Q^ӟq_i uܗYeNdRwEy G7|{c@ 죌88-C0vD0 HUثA11W~3yvI)C ~] {Rq ?PaP\brDZHc M/J%@-j[aŷPVdwſ9װޥkoEj_ο$}SZ0$1!i [`Ҕ~!s}Yu~acLx ip4yM-[^GK:/㋦d Ni=,`۠m5%8BO r8@8jf,V˸PO_gsGJHQFp` @@ aĒ9>Mݟ}p%$q-dD$ ?j^wQ]7LtS/ý)Gl&?7#J΢&s}KzQs0I9~dQU9ɠHw2rg#8X /&H]SYCڣBѝNwcQ/=I抎(abU+A+q;"XcUy}K]|3/9?. xs@΀0  K8ˏs?cGA!4^IFnewkУ e~T@ eI:\P R ` -]fvÛIZNPH0cuQV[X)Xa5sJo-/VW(v$!zQ.e MQO_\V%X>{?g{epnTn0"A>rnӸ+YyeQqu~ӟīK1VTb#eeI]mG*L|4-+T>NSeޫ=Yc ?:IEB|8v @3n[(o#eokmS)%<ǹie!X[r~'s٬ PE;1@0A`E D&k4=o7XZ&%)r"2峸_gZ;2`$O~OmD3T@X 06пXI]j,w}!.-%ZtI}gFŇ,hы(S78^LFu;3iŇ=@AZ)ԚR2J\Ä0 MY;\hS3f_xn')T;$vЬɉ*=ttϣ[mF&yMS6n2uZ(L?kQRA[?R;I٘< eҶ p֋~g0h)dTiᒋ(lRYT+{HxtߏR5QF^ȭ rmpߖgyyfsk5mpR3.Yo*=b DfNA~Ϩ0h\jHpcZ˃!8ٷvƴ.v$Y6 Xf 2p vMX^M1`XK[q|ͽJڽ5׬!@el~ F2;Bi2YG1~ޛrhCA$x5Z_TS# ri~wNZZ7 ha_ٵM[g'Q1S^k7eMMǑQFQ_ Fu;С=Xl!a8nAtŚM\*Dmڧt)s1(]fiihϔbQ r%E, [YwFHvoxh4w)='̫xyEjr1D Jϻ;SKgT@̉m2oj*?."1NF0];|4ZKY62%`:H]}㽤cLd` ⚽"`{TrCgܱ\Gɻ{? ;` hʐA@ƤaqKؓ {zj}յN& pHR!iE #w4A~cBw ( Dդ'& UЂ6` "H@g^W]FH9|NιTBf̔DRΛ 8 uZyNKT) RUco6rǐ1x:M۔YۻyԜH @kh(6Q͔iVq%a6 ,Ɵus6fG"b;;_Gܕz?_ ìzH ~{E&+ EZ},4is*-dhm5ñ`#}1+˸;ܜ@B%+aL( G W'nYr EvGP8_;Iżn6;F OS1k ('ߙT~_ ʄd̗v[(jSyΫ3BdCq%Pf)*mw $V7VIa4zTTHRgn_Ö:sO|,Z+5>'+*-:C8s2m7,)`K!(M*3Ei[Ÿlb0 OAK@֜@ H=¬1 ͛*۹39Ё.By_PѸp Q8; T_c0J6S<:  ֞QQbn-hW!gK5ӮfYzYUVo+L̳xocK'M;XU[@r努;gF#(gSG YIDpbb.W*SD8uQ9"F+x,Q42'չ{sg  rYLjN:3+hCbsB:G(ڻm#ͅSkvRozhx"&rP|j6mO;;/Ҹݾsa;w70RFJEu2^ڹ)M^6hV3UJ]qМ 1(a\JD:7f3"fXL &4XP oc\ tEBjK3qoR"ivJǐ:zMW/,2VuR[i3%4 v74 ͻh@@|Z_lzW54uXBՐMcSI7M#Q-8PPhYh;HiFܚbH%)<߆f}b8nR;ŨV& 췘Sv%,WslF0GgYPDbnw~8[!fH:,VlӤ`4!Gp-f~zw~!p. #V.zdNj8{N"b:F N'4bG>??'xW6YGuW2Q['eN;EU`YoRL q-8(ts?l`>$8:6 '+J4rI 0 @(0+ydݐcO( ){f u޵ǔ$zBA6mۅvM1J_T:Ͱ9AaƏWq5Ql@H IUHVzE1ktJZSMb;c 341u.u1;-47@!w|7y~Uaxa#4.k<-USgt(3[*7}!o*?pj\e_w?S71n -U|uy20 P-u1.f+:: C k+-=tƤEd*~R.HΊ#ۂ,:ɼ^ܗG-#k{ ='Ϫնa]=->%Ei}:ʗ;Ab=D|.SwmgL޾L7x]A!wߔ񛑌8@#hO>:0!Zî|@= !I:x;D !!ĂZ!VŪد 2٥ykk_mBYer \kHYKs ` na֕Lwc7P Th}Dr?†HTEd`/Aj%505n, EbyVHWGQ&H_p*'@U)G*@:]x[{qWRTӤ`!78*Ԃ ó_@F^7 J`33Y?\&J.T8enY<;VbQajo:+~a|H?H0 !a-O"]c%D%.У A?`|&Bư0o6CZ*q9G?u`j*BH_W  'l[ˣA&* lfՃw:dYDFx}Vec9os.@?#_xޔ>nx% J:*Q|ڇɈ*]IZ^(EA($Ea~=Z c olhvI多2&N~XMaZhLG БɎd˭oG>U!IJC4  !r \Gr?5 ` ϿZY p78b'<]PBY J" c8%IGy %NJ G\ZW5pD+w{{}2!X"XրkuԀ1w0[s;E|(N6(~cZeXFkHA" p-9,m[un#g~fR,rVvSWfZ-qV&ݲ^X̖5}JR 9gRnȅ25k[)3ЪUWf˔;ia 5f>`Qx6PQZpҠ:n,W ҿ#i7[չDل`Je=0vpL "xn==&j 6g:tl?=΢B۫J]Fm{kSNH'AQ"AFD_n >ns5N~\L.$AD:}|˜ RSi+`s 'xT @m] w߈O[a>> r@Ud78*9 )2 2J[[1#À RJQz#Rs "xruv{~;Mof j-W7:fx}nǡ׀?ǹg=XgH oG@9a)\num*DPJ6u|Я걔'U /:l#P'JZ@Q#w3Z2{@)X|>}oXt (gʔ4$tŸ`qX2Z (  #|B (M$.T9lq1] &a(OQ\q(w0ԃT,?תQϝ1tky9+[iMYWH5TPUA7ԪÉr)MT/YѤ%i˶ G4Q Xҝ:*,x"< $4P-BZB2B#tj # Ȳ EHAA@OYYw~C~'u~mnI70LR4PB6I)Ç%'8T樓y˺ȉj! _6 DFV bH-2!DEAw{Ck] zD.~Dipu|C0pCYt\D1=^Fә_O! 0E~2Iu@֭M\:J6ްrN *6[c#\Ҳƹ7 ]YNScl|& W"=m ]9y}l`JJ"f`yv?;+ wB3Cqt$Aٍ?K[{ Y2k!W|j–75F_T_޹1i iKb(SC/.Jyܓ1& $dd'R\l 5T4ٹV sҎ& wqDq:ӊG+iґgDG}9%j\ $= ?7EgiV ‡8| $ A TI+F(Cm $ b_`DȷO3)~jשw4f_ǯRwb )~퀟c 'N@kܗMWUբ./UyL 1 y]Z$rχ5/,6?L;NEx#e8"qʋC@ $߄.70|JIKˤ#=4 ;u:tt\q~mMKIqp[TF ^Յiq)ؙ207Dn˛c.y3kMh8K\YJa{fadx>=vkN*5@4-pd'G(Yy2l4жZQzO9sOяZ< #!Qn!8_Y%)qqE@c]"l\C& px:]%/ld_ÞV05z~}U91}>NV_xݑ\ ôD=L rPPc:T_f hIx(^(廘 Evc&tjo~,-Z Yy{v滳Qeo6*}{Roctrv.+,_?iwd~^}! NO@u9!9Zr \|"%ҳ@r3^i $1r"H:9~$G" u;љI~4qS&=ZUY &xm[#6!@!r "=@{_E=Fbf}Ӿ&N Nib@uT{yGm~Ɉ4vtmQP"!Hwwy)`45/1~S@,Z6~u ċ Fk{1Ժ6 {iHm.Gj54UzƒX |gUIMLgO-Gh6p<; ܧ~_ׅ)6ڈ0*JJ,ޛ"5IP8\ҡ d<8g{>הwcGn!Q f B*Wq 1;9_})aQBSF8oTSn(VBq9[1ͫUJ{UbkIJ:WW}1:n1مO,z |v'k~_([ f0cj(JٶEŶmnUh((Eà%~&׵Z.5,|`ܱ?Z@;S$X_lml%ŤY  @φJk- mأuJBl10mvVFsoҐl~Qo)i C < jm7E+M3UQ:y\C$Am?:e\/\$U98 ǏHFY<:Tx:h _&&莶UEcp03뙝Y`{w4oMp#(!:uUR.  [Lww%ϗf+:.jn;:A$O=L`FD/~TؖD1].ں`rsvCQTuY}:vS]z.ɨ?MkHy>th%ؑ3C! px 9Wvb̞ӈL+-3<r>\grGxB'ĉ,Re4BHWP$Ò ٚ.էBᢋ$2"QЭMef5E{Q-Gt[úLakZZ_lnN" ^ *^#ku θ9>%^]* c"!kăCZK.KLW.َbF8b1;F5޹GUDRݕ+OkrZe1O9C7#T/Uz:o_^໯??wSF3j0Q*Dt)GPLYz8 NÀh}A1+<`q"X'-pd PX@h .6扣1A}`ncq lq 7mj}Z;ޣ}#|0ҡ3%>eB+}:+@&V|[v5ގӒ,Gҗ1dlefUF āعw:7^_bxdHPAZ2*ޟz)u9_/]x- CIF!h\?s˹b@4MH&8/7֏C Gb봹8&O_Qw60B{ߡ*4u/RCrW E ! hwph˓“ٽ:,7fٶeA]20 ~RrX` RsF.gd8}QSs>ΊXS> IJ"\99}p[:mCvu].*ե̾7fciXf%sY;(a;P9Xt JFUL{+/Rc{ COb.zcpֹ8}J 'r:@"hl\i4%KznOwOv1S#&'q&.XD0dHic( üfr$bIOudp_4}уi& P|VD`Ր=i~oz'wn~. zƖJYPÉ4@fF觿/Q$@2HQ@a :6}7=׀_g2wL'IJiT.z@DB$ 4vvu5P`b">zqp}*x~/KLbd.f݉8;BCNRFjoRԭf;_-9\6NEۑ>$Z5 6gu#ZKє$:a%K$A^R &0_\yT.T#YX00M~lWW%hf]MN%'oq]/?^l,ѽcqu>ƯMgx-2m_NG./ӛ(8 B) b Ґa(qH?#:#38(;HǼ#V&?1DXU)\/G xlD\zɱ>p]< 2"jda`*#OcIeFzCs^+ ^IoǠ-Il.ǡX9iy2zC](>B .k>^CB@3e+ amqHD063uڂk*NO|._e33]ǂ,5DoN~SZ #G;s5qjLiB NOanw3^hu!jZgv]H*Uiv1}*DD$AmsJaAù?_{Yoq:ZBc^]L 6u1 ޕR)uGϓ_1֌ ^x3^Ā Oo0Fu ~FeMKQЗr#l]T3'Jbm%O:0حxj[ !a9Mjc8 WdF5ՈB:WL/FUs ▬5ەq\RH8aJRLj01A:{7Nōq%7 z‰F`ZPg <8y@78 (a*ȅRs%{T.@8AAH".,TP+}i$nKFUeBkY0@㠜 f NV4|MdT &|O@#xZmJ"m)+i]VRAKj(+ 06*Qq[EE Jpu`P'6DbV&U 㻊GJhHAfˍYA~K? nf1sęO5JưzUiIL4B DˁC(<Jcujٴ^ԄC{ԫaXFT\t0 S}_ V+E\*+b`` M:҉Qđ"F"I."\N.}I^N-( e׬~qKpv&V@Ԡ\5g>N_ҺQYI`eZ| l SnñEɭ^Կ?@-bgmm+A R*IG}>OuL8uvRM$,t x $d!X\h1 < żWnz{/wgC&ެ00ݫ{$b^ַlra UdBstwʽ2 2%1#&[pՏLt| ^:g'sf|J= ?V.&9|Ǚ) f'TD&H:!P`iX;MH!qbOCl]kG>OD=O9O4\," ZJDkqׄdbf_M ax[BHN4._zBg}vwnmb34igyu9~yYS'OJj$: ' Zn=֦Nf` ϺʻsCwY_f|\s v}MW4F@!SgcyYS˓gN ZO#qiPʇڀ-dEa!D9CLc9 C5r qBBLݐJ&̴! BG@HXwT<;V9Qt"ϋluz+6{ҳȹg "g@mФ[_z\( V¶ 7oj}=g2؃aV*MTVM%\08Ba dc:5m:?T@wo9 &CP9}UdIcnjhY %P(AP `Oɵ2县d 09:SÅ{tG+ $QǡSD8L:\:Tӏ ;,v{V U ~psЮ֔Mu4唴B8i7R SdžĕB+\n1ݺ|1o _1ƉULfWrtmro8+a/"7ZHҬgqx`|6PfLJM,]iZ]2̱. }jQ|!1 NlZ5Ai500ACzÂMU0{Cg=FH@M~N瑎̵g83CrBE}S۰TZ;HJMj~LkEu))(@j /s$s-ӭ35ƿIju\H >Prd'g^ǻq+R)DB2 _ U >ƶ ލ^ : b>wLa5_Fяbc`ٴE˵7޹zL 9N; ;LH9D~wt¢ppcИre B2*Uv#-6u!U*V}bS[R'89(?[7P7J)"1i`]'Φ~?uvN %0YKڢR^\JZSsiUD4K~8 -bzVסƬ-K̜pR JT ! pBcpKwAEo$҇I]5d&L$rDq7 mx-Zyw'̐vW eŭq2&]f;>lV޾Cx4'U5{[Xl$\.^*E D 1$Г& 4acn 7C`Ϻ)!H,a(+; P}(YjTzckulGߏ;npHE.w ƚFDA-FItIs  s>] %-<<& )>+'[0V6L̹d!=ƎLT@PFi1fʩKG7iJYGyIlPtAX"5e }b!Zp mk>)/쾐pK3A f ?(.Nd'L8^0|nÖIHN_;B$"q6R?B%eWԣ\zUA~_9x`ђof=z2mB"{՞ȝۜ'u:.ؐ;| FɺpX8l-2\K[)kz~UP p^"aիhC\֊5)̤ F(6Bi]ztZVVGkzw!+u Y5NdZ\E|$+Iy+93:'? a< 'KiթzYH @-N A'Df#UoƉ?XN#zۚE[3/tUEѾ $"6)\xyʼ.eW3k"5B!Q$ ͼoKfˌȮ&1B9-^2D `Qh{>gc+We&J5_B1c-el2, -<œ: u$0 b'Nؙ_eǡ:9'i%3E-)M:"kP m9XMIҭxo&l"в  +FWRڼEA`"'Ki{D *rἮ/_Z[YYÞ 0$$i͸-%Z9[ҵi-pXQ_J\ZZZڦC[? &)n8;<ķtI }'9tÆB"Te1qC}k --7wQc<WόD7bWXuE6kZ|&8J V BHCB *fDk*D @ۀ@T2M JD;e)]1AP?W iBmB bAr( H i (Mc#uQhT%S!P$ 03 b.]T iPCi FQ S!IGͤrVRl88!PW;[-!Wsw~W6gz  Y8М6/Owߗ}_+êOE?5En=~.Kv&6\mabF(MZZ|wvEIwv eO| ޿?zkf.ŸC-a#c*wCP;#fw~Ha'x t'x|6a;y7w;=}նF <慾e/w*ZuG,`C& " T[e66dIPZ,QJZ,#z<(4ceR9:$qͣ9uk=pҹD<* ES3 MjIlڽ8ܧйSN[#wv['8wm"K˿Bᾟ#q=DX?{G yb. ~{42( XJ)UTGSt}mmCDo|SnTa.m9HPy+v:ňxFwqKڒ 4l7Ⱥg0hkBm%>ci8 z\vCU7eC>c1*__m(=;9Q""C̗;*Byiqxe`>md_-weܞyRwhTh'Hj8 Z6n"+uYU4?k3[WZww\}^rP)}q]AD!^Z(`sG>L`p|3~n/lF' ( %:5gJ…Y 1*fe7ւ6Rڜ69Z}k`([s h:ܼ35zΜ8rs mEHrOk_c5JJ]-YrEܻOx>74)rUِW*IٴjGE|Nھv%A\ 萨UBzX/^Pw_5eTU\F@DB'9(h c1XO:4qj>I_x!8à()M0+)a5y9ӡUH}Fan%*Lgq&"u#r Lww*HKNʫї)EG[0Hl K; sJֹ|W&t岅3+BG:,vdPLyDH[$ hӄ {EBUFUE@BٕEԂNЛAnTG 8B3s/2mTMHT<Uހ' +@Q/& ([2&޲U#qTVC%ȉB׀LFJA {bAŢo#m 4 dX BdI@I$I ID@~*%Iud^;/qڇN4i(0D$g(t{EjX}"(!" C$(cq 8ĞEOfC Jh" fURDJ@Qb <ciL੹{QPSg4l`DJ.HM  7D`( Dw.GygP9nwU Utުiu=1!\ U9mO|]C#2߿i,쳨gBӞ=Sa#]ӷHǦRWᶣ92:d|3wb2@%+"\KXw1:q`M1tfq8B+`woPˮlmz猟7Y6ᬢ~  0Ѹ QXJ cq+>g}[˷ )M3V0=er@@kF%ڪPFo+~:~=.}wQ+oNXq̜$9 מs)/2؈A;+LXo~S#".8 E-.*% DfC^~ Ia{?DzJPή; '咿Mx怭LᑽH`˨_=ސA%7:]/[jЩ$n<-*-~,#' Xm;n+zsHu*W  Afr[rs ` ~ب~Wފ.o+(/Lb)bYU G-5Qmt8R, (kD~EtU )*FLȏQ"{ q87OV#MmkjʯNrGN+S]_DUY}!`&hU3<>?^QQ4`@ b- o<]UAշщǁ<#zΗy#Rê"Ay379 !5tW^q:B&-dgT\HX#vRMӉTTBop2nuº'"eZ1 kT_#2[BMK8ԇaGwj%Ej٭IUwDNbT@H ʄ!x,ihGC8cwH@JY\r(,4_~9PE I8Γ,)| I *Az湘,WHJ g0c/3qmx__7WF/^ZK@YQBl|$֡u 6,VMWLP!>еAO⢖hŵv䑎;.3*cY9nOVe½[k0Jwȓ_kI.-lHQdB`wQԄ"TԀR1^wF6j jDz)#Ibz}OB0LsJ#Daz::QAp[l*,<f4>ǽG7f+mO~5yϡߤ*j)׫ghA1G0J!gZz %MKI򒋲 O ϼ=NO %f{0w;N~HNxQP& qeS^DLs$Y{~o]u( 7iЋiZ }e(7+4u|7Vm`ZYgzkZK"&{ ip*hʔf0P*yH)ꙑIJM%z!<(D=8S#.w7)FO4M23)EI+#\*HQ!?Vp A 8>Q*> $<;]Ef{(e5ڡD@F \h.J~5q}z#D'YݜCU:?q Oq~ߝb,Ëdv 3+M7jSƚ8 Ўgcj^o1 'G H2)@pxm ͩ9䶠sx7}/>?#3S c$Ue%A硚-Æm&ۣ yLj,8 ua-3s˒kgcXaOIZ6 Pkw@qM~Gn}/#z_,?/Ԕ/y:SՖwuUf ae'&F?L$S`G|*H.r@ѭN 8Kͷs6n~w2HD #`֜.v5jBbZ_qZ8ͅ " Ⱥԁ$X?bxXf=ύ8^1dFG ?[9^> ( ̧v^*:3Q2`>[RE~ R![W/!jk;Ⳟ`!dx,Q0bĢ - t}n30;fB{jȳMlkw?;_i!gQ9;hBHB)mGL%^1Amhؔ"{60cbf8xԾi%eW k1vϦ0_W;%s6KT+7 T!}B ç7% 2*ҙ, X8 Nb(V8H,Xyn.N- vK/ϔ 數DٙYM{za~7,{5 Ss?Uu H]ԏ„Sqˡ3Nd,erXBZԊWگe+x榰 ʲގ E8~:G/8?כHG^EO 5]V_ݤovGO0Z`"qoyŞ5Rhy9zM9LЗyK )͗c$J;m^\lz=½Ge˩kSk}t4l>C,~F .ur3SDM j |`,B.:g/٩/ȳ#C=|]!y_^ gˬ0s6p~gkE1:23O嬶+%.X?3mK10/mVA0R5js~|g;HܕS\h}֖zH寒f<_;&ISM]UD6 !PaK4F>^~.6 `x>Ak[8x5}Ĵ\P0Izs0㓝*Ea]X O<QÎ;^=Lz FXeuXr~l޺*dfiUʸ)H"۝"8\0LdDfm0 Oe;^HQraČ{}췁ƘzRw6pY'Վɠl_F;*^.ħwο7-]P\^q#|¹q=EG=oFv~sq^O#nٮXdrw4:ҭfH=HT Bo05J,#=^8d8>$@~ro>{;oo56oG꡵NXZo ,R/znc7odsihAKH+ P ' 8G62#Ύ3ܒ*ϰzkK޾λqƗǗ{Hӆ*VȬ]($ɧ~{/K;?2&U(%dDdЀ:p^ܚla_'bA #G]^BRJp~Ӭ]ok.lICq5m el H_uޯ}ݼa\-XnqlՋ#3$4vJݽ ~Ar"@|'Vcs`,Ⱦڷ7[o^+n L΀wa.a%mH(bԊ"!(q2".Ra%/TO&Ղ(.j P*]QU"NZFJ@B@D#^` { I/[ 3/E4ЦR¡R)p@q:0̸lqXX5׊ F^jN;߫2Z`; Wڇ $,eiSԀPAv ie0d2 7=eYUEC7_J]V x'o@']Z>ڎ_:g9;3ʂrݜ/;. t6Z t^; L71;9zP`љt iw/&>c m\%aM3qJm 2+:#S_HJc3)$KKD]|ʢ|6a{?'mXcd:,r{ p=R ̳ 2 Y 蠀ROoU]\M[Gl{w7zWbǷ~\46i@.xiטA pe )vtF#f8Zdܙk =p6Mg)ո.ٰa].,^}`Vj+nn.֑B:̍sm9g #,]J:oK3eϠ@'NHBE"o=͡&vWHxHHGtZXfy`ȬP/^.wӅ#!+(]'0yL X )lW=~$@Ayl&ŧbWE]R۲,wx9$M3{2w{CDF-s ap(Hf`MK").YfJHAgEڣqE9Z 'CqLvy9|@ f PV%2ƾl0u{ ]u=%ZrFL%Fכ:ˬE(O#4o VRM5 u7Y BƸS'iZA~Lָmy '̸j Is1HsFqS]J3 Cv$d`Ȁ16B-1  ӆB{HB!!hH&4c/8-HM&%8hd/)а9!H"Ai'&g{8<=s@ߛk:w9-9|tč{m~>R_IfbRZLiv# xݘ0@ HW],}5daKu[ɷC=S%,+c@h2n4z'-u=Z4| Ü*7~Wt]bFE=OOVJZе1,|: Y}Dh36dtX2]OA' \\7feS9R&g1MQA$y`P{#ȀOlgxF}V/SP͆w!,Q~z}Z`\kz=]&+ɖ ɤ,@W) U7"W6N3مdVg(Dۂh110"Yg-PhApWe.fXώHOilz ܗѱjTHBc $\ȓ +qYbጛD-Ul9wV>Jnjb̸#+c5xy¦W2ۮjugS?P&Yo/EēeHJРy`!n#PS]JLlC'^;׳3\xo> HvيQ+1O~_jD ¦/C;sWֽ%-?Fꖜ˗B'pۜq\uT3{.b6{A%EK-{ \/) 9xp Vn0KQ!"@)ʪfC2o/^ÓO>yL'i;}æX]_AQJPݥZ봲[se*md)W)-o*DYUyHlӚ-1Lf\,p\"!ժI6I4v36'|[m @{/Jvac[i̢/; r~f[Vy73i0U R.~b"-w0aU6" ۷~zDPq:j:]U'vld\Xń6xc$6<X%"*Y@#:'NtJ"M?79Nu Dggr幵fc6aP&cGT*.>KPQTu8pD_-7O3RqGj:3?G1I&be, bJ1+1#!*hxKOcm˕#67BHZVP2aA:UF H0F1>rH1;X69R(:'ՖlyIw2 xAE`pe\mhu뛕amy'jNu*7*%{rr)Qc+VOmG{Osi;у㹦uOg |OCy'+  6/X{JhsM1Z{j\={HaիElܝm#cDZ\EbYwil%(/}\b^) ;QiݱJ7oTv>Oi\шpDM/Zaā M'WbYU@UNC0uMW ѻQT|̂U>qJWtUq@ǚxu]΅Ui_[|O]߈ÊW1t:ŕrR8@8@& U R *Rx[J.|uTHFo[sI9NNYz6@88 2p$AB 15E^quI^ 9nb|sasA'4(ТЦS" 2Ywq>lݥ~p'9Slns ՗g@59ĶvȋEa_HΏuҞ>( N;xv}RJ٢"q0ޱdP ,Sή:+8m$]2xT#FNޤ}ׯDNY2l~ҩPH|I iSU0Ed +Nv3igKeL;'O}InžH??# 8(IJ]jBԢLA 'm^-8XtH@N IX>84=Z%40:"JCѵutS;ʟeՊJZImH~.+t,Y,yO_aUWN}kߴ9 t' `±8]px K>?dT'(>8bLXBHOvEF$d"k`=aWeyWك۟:AjQby|)BD6}Εڠ¸76P ƼψCv@bٍ  BKC(/=H^#K,H* n>'쯫T>*,%3Q)֯P-E {u'x }}˦:Iz#f7zץexb<EwUh#7Sc e # \UL!A!E5"dDHXA"1D\"s80x Q=K3)EIs"E,Paה'^R{ t ` Zon'8P8 Qm!+Kf)Q"Bn@1Qe&%uzEs˜B%:$Vt̞z@$P)LoQr$U(*jU'-j$T#JB #sC38I,[j@^HzE%Uɝ qd8VF{) Vت$f u*2S ֒ K5b7B># $JD@ r c m㠻pS,vi+e9x  + H#w\k0Zbs)uΥCұ=D[)<ǫR e͕,蝚 pX~enG]x)6XF %|6@;d><տPQ'oug{Cv9kfZws..h^ёLK,OTa"Eߛ[`ZI@?]6#>kyH)eP#~֣#l>ˌIKdST)9mjJk|`L!OzHd5)zz.Ir.T! n|!X M8{,{ * ];/9@r[H!3h@cWfԉmN~'(*x K`p N<1zlXtTAnr4^뵠./d*(<(+H0C1V z,✕&d~c!RIfO+Щaid{OY$% Q FY S %Xbݒ˓L){& EB$֠ ̂ D`zJ![)O\ɣJbf Y g3%REaي5,4JHf"W=QZQ<44CF4YNTFx ITx/C2#R"Hna9'8Zt6Wi{4 J_gFPUǴǭ|"O??SQǺg]Nu:QgDY94C* @AɴϷ;^MV^}>-+ U#Os[!̆)榌[ nX^bY,i A5AѤ$l%G/2tz)_ibݬ߽`ts7wQ/ ]͝g28jeYxv{Ϝwz- ;Qtoa ˃88sPNp~ Qt~o@ F,ufDdg~eJL0$@Yk]>U+; ~sC+ [.g~w*ɹ f*GLP&m :@p%@s'U\5:|T0,7  *ʝS- !r8AUU +Phtci"u8@SNp"{nl Ha}ޚőEOcˣH Ekyhe't(' $P ,{QߠzJ&)I{ڸF*LiYE9"v4E(" "GL .[ Ny)`W3;,EF yT24/2<1/jAK+TvD* R #%1)[&{_W b΀b|!hD_'j}W{6@;( lQZv]l-h")^S@$4E]iRʗ;lQ+ږ~68Bb@Rbd(fJƒPɸ3d7ZwJ F i]T屡Y0ْk*oO}/vj(N.]Ǚ"Vz(B.RBff 5"*ia!zlF>9UGk~o⑨˹rۯ'k7yK՚͢(8yʯW?LVqΌtgI$_;X6TiB@E%),<..,9!:8@ 7Iio[C!6w ,:cxV_6aO&pssX !zU5f rD9ˇAou ??68#$0m>&$d15rQp !|ifCzxooGkMӟ]Ao@ue̠ɒ_e1˺Qn5 Eķb{<{*@v x~Kt[lQ3%AR[TԤ9fIC ǹ 2 KbkU*JΦwVl \ TRϘR/n >fU RE!Pt5,_D&RлyлTž]k6K`Qk,_x-)9X|J2+yh1xE_VO9$_LJU&ʉ]srXIʧ]P eFnp~z8n{y\\XVKH(KG|XLP oOF8Z [1G4KyuFòo,svN˕i20kv׏f=[. :we`[#?eTGsx(ೱhҲ|bfs/ (L¤3a`GaTN@!K =%sVj͝ئeluqmםbS UfI d.1 L1\!hYuSKGًv x_&)Ņ'}a1P SZ@OwAk'H.F &5P[|zOU 9iGum߮#v7D&vҍŬBbV k@+YThdK"c {⎛Й$~-;CSTVi7?K[|Μ 4#C OD@0&8}nd4}8dH#PNN}E]){ai_aأJv!Rpy7Ji3 8P0 E:^29. l!v8XBWfd(-ŋ/R7B m_qaOs!gQ?D?wWӖd ~绻Uyq2zXnFT , A&#3dSTDGLLXbNK+? 9%Lٰ3Gɓ\хuձY;W_Yy8!XpUю"G>>*\$>?KL͎V%Ssʌ<7'Oe$CJlQz7j1 '/Z_Hߌ\S* !L\?W-a3֦71zØNoqE=SNG+ +b1* ( )"PzFՙ)I@݈0/,."=XffEw|Ώ*scE Ա5tؐ%} x@%5Z"6#PETNOF{ϴ_z[X}6](1 @޼X{h9.HD=MICh'F-c5G:˲iyj;y: ʔ}F싞y+N)pI2FD-3<#厑WRLޤ#k4氮9c@ =1b{.2b cV0a ɢ'f|td+?&k]NwBeBk3a !DH 56 Zg=JI.QcvZB)CƩx";;?K{ЮjV #&R+0s{OPeYbt{"?)-aP\ G$ +m|LP 3+ a4|G6<սƩVӻ7i1>%a!O>~)hy4l7&ٺzv.(I[/Ԣw{u8>)9@ *?K+M YUfG4O=:2O`vv EtIt -MQHP$~aC'9á8k.7lB2F;1Ls #ey[blk Mf?`\bDaIyy.7 P5̊)$H F#4t=sMdqDK֑.Kd줞js,ҵ]hvx&W ?p݄MLDwTJtWGA!%ݦvZOm@RF➧Wأ4)~w=k>\WP7:zHݜ&${HJ+sb9I,[и9srKsgs(Q !~_GT@ ߅rKJn27z=s54'ת(NddsM[PD(7#>Au>>`9m(-vc>uomvz7WW^wsV{oƲ#msET6)Dӏp/஽s :!_'I>סCg2FO`&Y@K (rApoOe@aBTĢފM%Ne·)iV+9M{nzIU4CPST$(`u(y7~+,~ZWa/9RUZ|UN]f]\F(բ'g*~[_p?5t>۽G2m}lY:FN#&rK`J^R;x)?VjmJt/MEW_yM?17}}}> I}Ws=~^M%3ޚ&~jj=uZOC|x3b-"){Ô򂟷}kUhz$!p @$H{HjS0RHC%X ú(tUwr\ 7&;UUfsϚJsNStv+ifTˑFߘ+!F(_Mˈu#]~쯇M |u ߿D<]+#(67Gޞmۇ!MgfGz̘ruE?, _+UsR\,·Kx9Lz |uC/V~z^b2H/<7<~2.,k=[oC [2ef5M:-zx/p˻Ú;-_G/ʌt};6^w `59796Qh4חl)<;J練 ٽYa JK%xq%/8L5)ʋH5i_.MewO1`R]uӜqJJJJ{9ju)tnA#ZӎuQ`spQ>ܾ'Q2"A~>oEF(>m.&=TcAhηi_YX3gll(h,ԍ", Va+* GQ2K^28(?u~ѱF A.7\`wN[&'g%=mg S^ y_֮u33u:śǴpqC})HHϗY\\3}w*j)BzqU >u \I>!:AT`BRQJ5`h_0KrTKj<`C0.TiK%>ԈKV_(4ə KVe2IRm퓧Gc#GɦoW9G:TD-:z&]ݣ}ׄC2wxq6lwj}Q,M~}l,Mݢ#s^-ʮmϝWsj|[5X;R'asx;j]O0J/vzqd; <(ZkgW9o9}.9Pu躚‘G5rGGxt::Cls}4_*6CI͂hq,?4Zh*jju<& SSG1qϖ~8)Bgk;;[Yz}v^D~K.fF^-8chc#6-N ·hm |Bp zA i6̊GuuѲٽ=D3gB/ejt?;RH \䬷%iY) qVLTC(`& &.f{ jru l, ۈ3?Ys:!bΦg7䨅IܾR5vjn6w-wӴYj5떳 o33&u{Bz7Iy uݕܬtRr剒Tvk5* wgvooگkӷVoOtmbTkz%è퓦yosrs6ݎ~o?{Dߍ? sNWѥ>;sTr, QrXy"~R_XxS%7ٙf뷯V}2ۗxk5 l[=k*GGRooou55Gޱ(øԹf0PH&UFF!FQ_ NCTZ#F_".|5}]gVJԥ=vcaݶ½DH?ƫTb߉2Mp?5r-?n7GMymΚ=EˡgJG'J dT&,CnDʼWKNV23郦 ewYRߪ6C)p(-\+l],4|h#t t(>Yi+gxAfgJgu6$xgB9wEz+ Y#ٙ%] L>yQ; r{lGʀ GE EEA ="4q>s7UMWw(2tJSgq{]M;h]ZxY(֢'*>VM7 /tIE9u߷ Vr)u+ _zH#CkxßUS0ĬCƲi,ܚh.Y L|gli8ھK.Å=1pm58kFQ 2,@a2Wswu&Sɸ*?8o6qq ~{6¨ԫ355A)il|R5@poʽ K>\D-B(.<#,*/<ךҴXp7+uy/v,/%fSULٷBkU|q-kp5-QX 7Z+F',6eՆfS-Imx|wXPA 05)džЎ4BA~.+քR28۽'NۙO8z('o*Kx2:~8#i.twLiIH9DU*p\&zWԬ+I8_ﳄ^u?\eY. oEkI@u8ؙrqIQs/!#Vڎj6Y5pr3{ZJ ժF}j6zn5Uٯ[TETLxns7[=9E&]]H|GDZڞzG-px-pjÏ`z17X;eĿG|/sp3QL! -ڤ-Z.40T>UH=>]PN2y7 ;=h #pyDPiWhM0xWq*"ZI:ז:^w9CݼwuuEU *"%)nywlΰ:~ۛTճfZeXҬ\6&]NHO5ƹۘPt M` i*)gtj9AIE;@ Upq#+g~OAFsw~{i0>˧7\ihf3#ޒ/uS;W`aeH[ɫXHF&A$ZZZ)S_-j1kp*V,_7ͻJm#v"8- >&7?C;krSAkeO J[`vvW2j&zT}$]4n<WpŹ B: hMs(zJL\}UK_h31oͿn &}ەY~K2?fOVԡJvp%nϢD`88n,R+o'w9ȭT;u 6Av¦U(s *T<Ԃd" Y~7)߃vcH~`0[1 CF6 ?V [?KMq?u[?{r5D=AOpߚ9n޼۰h/ҋ 켿_~?i͊m/ʤ.Z;=-ؾ5udP_o'lݝK޲ lL6UIl6d}(K1LA$2Qۖ-;jJZHdSa6Q"@Id1}wJFzuج:GCݔ&j:z2Ɨy!c酘"ߢTW+\_V vS nͣXLw%E?Gq1@芨2e9y([} S0GódfzcA1ǽJt?F11W}4e:&6mrkڵt!CH[؟4Fް׊eg2dp_a"PBtyԴ&<DZqյK);NՆt҄N4 ݅ͨrگlӟq\UiQEg'nFh_&Jb~P(kE-6LA^ Y7/d,pYҽ/2&(Ro~F6;Qψ#v1iW[~-o\uVюݲ-[!ѣEy1RŭTNWogr[ۘ8x㔅YA|Fvv|y|(*s t#o|WK76Cy 5;7L`ڍZYOrzɱbp}:J5R;3 EBеsɗMfZ m]覷t%srN5hRЀsH,(Xf4{6 $/~Q)0"">D!;, b¡WR4Np7ܨt `8" B, 5ݷJݽ+~qdxQ`DˉQg/৽%t1ethqY8Ek:tLOb@,)?6߻PȸV{ʎi 7}O#WѪԁ}f]n 7A)Pu5R@]C}`\&"Y \dt~ey/@Q#uy|Ճ˚!ߩq<`[&m MMW0sqV^iTI ękYJKw6`l||EcUB՜i󲾕R!v-m<`BCd[Po3HsjU`hBWMR[Th%.ݤ 5xHcDӦ@dFq$t'_JJ,x32P '},Mk#[q/uYع#r%eSYT8%%3|Uy+v&7$.3Md>sl{w>ulv YTmxě'ޓRu4]uO5{y=V3$ᡓ^}r ~\-0@dlJMl`HTР[7A Ms@ ~evxMoҪfսlk|=58r! vSf96/}:X%v "CQ7$ wLy/2ʼnZؑÜfVĘ,@9s)!HRӦt.Fv:[`'X&["az_(ʤ:7RsK!mdF5#G+ɂu q,jes[q8h c++>xmpE 2(@7o֡,Kk1]%>d?4Y`2 = ˆd3/ w4cTp,'(<\gTYƴW.tH\ (R&Uve[AmS(0+>R,.6"2Kjcz4 :g)kk( R(hCk.38rN`"6O ^ BLKH5+iΖ̺ bLԈ2hDXDmH[J?oJ<cՏ)0Y ,򅋙Ҙ=rwM4fjەaⱦJH;93mƇ^R!|!_P'q(~ ]+[a|⯍a9R۪!ef- VD:xgˣjFPRqӛƔM0~ݾpimbe܍\\[Q=ʻJ/&S - T(^a.7㺯5kD(ո~hlKnq$ud4Íe(#{j-1ck;ڟ:>`q@1R1vYÉ1 $ jC6^UJڇʟJmL@>G^@[_agCTtܮ{!yfCpP۪2͘ W,Xᫀ˖[n! =[C.|No7CξjdjkO: Hz@>E;0Ie5_e8oR lAY!imR[;<&y!vǬURRDQ*躾L] L^;T{-pZÞ1w5а3d$>`Mߌ67O9Jh}fFp7w#M`>3ľ*BȾ?mRFe\-?ø8qN14ƲqrjTY֫{O78k}w1G4h"}W-MkNmsmsJ-/%nFQaWnи5+NvXT΄_r@˶+7n޶DrSe0'p15leu_pvtxrrs,XoiMMMOPc~^]X[ּ<0H. gvabܺJ,Ag%ZJ-Չ 뫮sLi4̳ 7GǕ9`1G僐3p`4:̻ҶkkvQz.bPzPP['I~&C;4듄Ȅ5684BuY^DQiO4ο-H@ECuVm37WWy&ɇyG*n.NJZSK=-wFAIij~u>#u=**ݽv9&g  Ҝ vZ786YGŻǙ$)M.qe:ڻ>G'huxiI.A>q/[98N%.n/@׹v5T{i['*Nɋ16VRu*+ e_3 Ha`St=;돚i7 尤F=FnB\yvYoE<:sC?+b|\M#I3-H&%xZEvT#V" )[U59d}X.)Z 1|=-8-Ɨڶ{R;Ɗɸ> u6F׾*kk3"1,Z!tݻpS}MhWsٻe K/Gk{Gf""ڕS-2X԰^0=yeeMʥJKjZ kL6gc@܁buVWBYM]_OK4o5^eҏw ޏ#Xèh\f+=>1c;j36;(6t2\L*5ͭ,ޥj/olY]zo8+G1E@g1;SUS@^o{1'fkiI @QwvJclxڨ((OvW+WYsKma98޲ҒkgMf3vŖ{"BPt)ۇjn3kkkknV:\p+S냃{'ʠ}woooooNY/o3Ӗj4[W7-T,$]\zαEs#R㴝/3ǦEit6D~قa=wӳ_4 &j,W^ 6oݘ1tk;1T\SҺCvG|{]/,վa$p$F2e}JV7VݫO?FmoGFh0`sG UYr%| P2.AÇ6}ҷʱ:6^ZYMMMӋ)]pafCoxX1½v{(s/ȱcN>/Z5j_`I1-|gIU-\tbr^@ 削(Լ~/uFO0g%^b{^~F bw.ӎ:s&<%80gꞅ~BQ+dN [=H]٘)^oR8ha*69#,(Wֳ9a=2;0iajYTZR6M\lJ(~ @-&}!:y]*Tax$N;tB>n5H/^(  "0('O>Hk L3"@x"r+6`q: ̽q y, .4Ds&)Er,DshdCvZ@_ưB(VHkR6.D50Y))RjB? V`K{}t3z5A*_L}cۛPطNk @? 0 . jps(?ȱ Z$&+Jrbt yDx307ǭ;ZL*nsvtUkRL( ˛+|'̯{m(#tBf9O\~㣗Ob!Rm0l`"H_Q8NLumffLUB:-4RZD[A02}1޷y[C|C~ @! uM-6aL0$4(= dQ3G)$aฅ}@YOfWU2Ho޽9o,WIڇZ#r&} ^DsxX~2 hA*z4ĕ\p [uRTP$ +0K pJ(BS:&r+w+B!P*ӧ:D 3zS$AG\ĹK>B̓S5FSDB#+K$$ d"WFGA<wF!E,'@[F`$I.J(%e cT^'pJqH×Hy,_1rYP'eOyQ\|+y=jqQ*9 盔 ݴLX>u2r A@?Q~P&4FWLx2s792mlH18֒I[=A9aA2;5E PT n '7=됙0@k tmߺp:Tt)~*m 8MNVʕ# dD;0KbfvE9!BQBVcb:WaY"%y}2o:"PP{-@t pQ|dM՘2FshL@Z}UmuVe$z:58\aۗt 7M !ġiCPnޟN%d6hx]]KNd~bMϿ|-)|=o%S q'o[՗41?D&px| e%`*JN!K4|@o;.>ivw=#:{p |LQaᆓA!VcjkL(Z:zʕޕ)ЏV>$g!ȯwP#׎k=UUnȂivƋ*މ[f)JJST fPyOg=Y Ac@٫_2Gdf%6_H^C]C%cL@DD匞Nle(|HtgZ[؏qY&𿉖rFlhd E$:zP:3RE$,xl9D sGV|~٭>+=g?ȑ1io3w"F1Kjρb8ga8ZT1?3e2eصfDJ/+*yjtV$TA RHb ҸG] Kj#ͣ"Au{)K9Ƃ0XQ ;(b\&`D19amfT*ˊ9!syвhTmY.R!!d6 QЁXa'BBR ySAJ56YEH VJ8&҂֋"*ZT79IUg] )!h %RbnΠa9Vvkc-!o (jL({Q蹎Y3ɼgi͋KsFܩC *Fmը }9"@UKNtB2, Iv[Cd@q֔\cf k)W<( d'.%Bjvy l};\uKZ]%p;KD8XsZq@dp '8l~Yr  j`!P7!2!W^זS:΍NWA%;>$@DUbCj<.-%uS)QB4f_mߣM6NگOsFIe[@f諂zM :JE3r`/*iSRш48r)Vt* r@ҥkZ kUzڶ5Fe^\߰WarnG M|b0Q$q A4i9?)13o"x_b<9'Wǜ鋛]qw! 1}Se4D=; *>2'#W0iX73ǩ*'97oks<1<~/S@CM Y\" ]0"$ 7+kZMN+dg-xcqdng D' $Hd B( Zf@#+aK[) wd5/^+X4m7I9dp˱gËRf=JE0NLCZ DΟa_#o9!~|u#tx,Bi X BRRf~n/qRhBCQP.O92ʹ|}_{Gx[b|Ф_}ϥ:uS[(F@{s=?U;Rڭ18^ÕW'g@ex\Su^׺c?A—n(ݯm}h{9SfSn j$oף?8֥ܖzu^s' ơu t'*&{Zy֍"\_?b32/Ӌ&k7Nfץ6o㿙u5o L\g okGoQڎv ȏ5/ VcƵz~ W꜒E4 iuݹt  r b\!-${769,ԸݖQEkVP7:t;cȧ7)4Ƣb:H~HR \w@5vzJuo^ZLڮST!\ڋEpjc) Uj U*ɉ(-(0DPseWn Ꝑh9-cLvk>;V>ɬ RO5`Æ@ȭgJ. Rߤ@q "zF_f俟=\PI+w,ΙiiO#tdh8&=.Y ,?et!^5_Naêi;n,]GXyLc[՛F U5+=fX* 7۩Hzq+*pvKO#=9TlKrsCxNLݖ:gm<nБޗ~U/^'=AP|B߯Q6hl{oj|{o) a :7 xS{?OB'CjpF!x7l;Xfv y,6I}vo`3{>۪:z)]Cha7sJHM4BphzyWz,7:;xrߢ](- jBjrOauYXWzݗ6^~dzl,Mm\ S֣+R_V2v[#IӫH߉>(/aNT'UcŎtӔ,(gu7ij^#B:@t?hJqwo@ d;/{&cQ_DKйwU3;W@DX;D/9Nz0>HzveiZ.V|D1ȇ;zkGxjnw7,P"}=D k/%w;:fozVh6z%zf]O=YYX_FŠ+,u.1TQbG[]'s@o൸o>7ҫ-R{(L2:_NeXB"V H@q:[ E0ήP\ُrΪX'h:"Fj0`ㄼ&*l"{[xBliߞ` zC;R.Ӌ1|ZfE9dn. 4cGJePpK\ji=*3^XsVHObD) (vgJA8>CiPK!Jy%WY9S;ۘ2*M +r)׀͇t VĖ=A+*b/ `0@E /͞@ٵ(dfBI0_-\or98̥cK%{-Ԩ yY DdAo^| ]؇D{ȆagC- յ\f(NjJWFvTY@H⛞A¡3ln$و9!b'ZX`/Jz~5.*P9:,KCZqY o[^,5~*-"V4Ɛ6QcR-.je!jReneso;87-f"30)кvwU6el[mudXrh,kz|(SɍI_ $[h2 }j0̹܇jHlgt xmWAlNs/HX^d4Yt;Iߖc=UK4ebt>̗3gJ Ӣs̕*iR,s\_IhOD巶X\֔|*!bLӱ<Ϫʨs?YUkj.ĴD˰hxΗ8AM*^)0]u*-C?k8jg3 Dku@BN0RP[0.CZHa&B#DR(O0PA%ĺ}Y+ k MfNֈap]KtXQ_qJ54] <9ÂApDXd~ '[.܎]R[FH~Bූjb[`yvIJObj^ms!$ ,smŒLG2rVRf[vuWw'SaWafѴ:k'Eu!AUekO/7/U }FU`tj;y ;-quP hp.3c0w ȑB.RC%R j`dQp6CQxOy*[,ev4Ue*7)E5̴ZNǢO,`m\*G}\OܴF̀97?qF*U+DY: >^+3icfS"$@ @A#4!"b L !GRep!Cс#"!1rd|rEFc! 4)D&$! ~m6[qx=ZvmUܽfWn\ƿbB$A(JQbD 6)ZâjfJEOD`K &-ӸE`0pF[#\ qRAB#bnc;Tt?+ JҠ i@i1$ M^|kz&l%ҟG9Gq1K}o?_uk!Gm;S_Cɪu"x ߶_w(0=|U3wʊ!~$ozF!~rq n7 1f0]ɀvmq8Vke氢?"8qtގ0EtWSl`C`qO_ed1hN$jhLMc٪LÓ?lSm/CkgwI?q{]Rй5/5 V]թ{e Vj՜X0Fy1Qh7'J7]䩶֫;.[?~ӽ3.S~590A"kuua\cH\.`Wt!&mI$HK(=ѨP)r'ku?AaKNaXF )F]m`2( dFOb}W(0mk4r0 jMqRW>g=[3ٓEՐAasbEF~BWR/t;Ai}{vңqkPF1z@064ڌ`N`얕}A+O$9͋ fC_D2jQDw]uHR \I?E0A쪜v8>,%#R's YYXI1\ՖYswIm`MZi,,vV&[eWKjX^zHmFte=tfͷ.ٱT@;+Ų|g89^J =R[kk^y9+S0JI{Ch-^yx5H i @_v4&yENhc+z@TRc8|b?D?ZNnǎ>}]G7ہ6^Ά \mѿ=-"MϞ#S!NRah?GG#T۔,IT]=en5 YW:oPMrcgMSYY۵EVWnݫdumiML+T4zc5\i@,W&Z^\ 5=ЬV8cQu1W,{{n`>@Y~?Hy#sR$qe"L[rT]O q B$z-Vᠠt1x[Ѻ+HG:ݔu[$\'N?W@"εlbM~ض:%,b[b$ $ ﻡE˼R]e~,^2#JQUt~OiLƖ ntwMw*R]h #+Z0q`|1;>Ǽ֣>IGM4rHSe˟#1wFP>)]N$. /@Fv|Nۿ^]}UkxpÇ=23if㮩cj])aTnƓ Hh&@FxH#|`T0?_YwPV#?ZB;?cm8 qrp|!*Wx^ƋʮTcرݣV@C%IJ om`/*b&9?IB"BaMY]ŻoO7!kl[v;\ܙv&<=/DwY F! !3- "d1 H !bLA J!IQH@=oqz<5igCUXqŃ We˴O[d Q[IWhf+PIvZ$%.jU{2!’)(^ќ~$IR2teBe;l>9B@@#ώ2i!:z]<5|kHy%|˿yʥ c8D3X؀C" ,p(y!h֎f4p s]{in0_U7f֐Y 7uO]iL]ZgAN:B\7=ażߕ\o z mQ |dg_o4cI,d$b '[BAx܆qlOANϽqqEk"Sٽޖq8Gqc؏d3`rQ†)@[])Gmp~~]-ݿ~r9 &Êլ^ER2vٕ/–JVf" فZvdӯ{[1?Us9}~wu2&oOܔ8&1tWlwl]ƏCrx\Bs q[H<<C( ֹd6ˍ[Ie\<܄`Ww nOXɉz6C_ Wi~!Ws1aܖ"_;n&zk1ް _zu'2ihGSGr>@'?m3=rqҟ}Zﵶ٬˛Hrxci;j*7Ԩ3HMR??d,$R޿nY*q;9}vކX⻕+쬫qlGɬ&yi'" Fmm-q5] Uꔊz为Lq%-uqэؾo7:LRJiw36n CA0aGpp@mubPq܎i|0qq!'T_;(? n,"T+9'{ OIB!d:Y{ 4m\M?]Bw~n=14##M&J"H&(AO@ë~wvU~F_r㻗Uvیj kg:*1,T@8}8~׏.3w{j[^ i%7 91d˞e]6ff[s6,vD8J׌ʭ%AJ_quMKT[֟Zx~zOLN3WJktm֦JAyXOܖt.-b못Nqʃwxڞr yĢ x9COĬEyok_ oa1MLSUZY^xe%"4AnN>^L"m=ɍ c5o%tC`̍L KCӇ >gP(#!7'']}jcy4Q=m}>gv^^e`~`cjz_*7hrT0` A JnD<3/5c9g-n9sIJ'6<52/ ftST7LO`7!X>_ݒ*믽i_\i2ێ6`+S+/*W-z"yʩw-LGc)ǞK7oѧ]ѿеsQT2jf3ҺU`\@,;Lq(όoW>Ct7*Itbw4mQuQb⑒p*B:#(fRR#qs='S,!`Tg<{W͋~[*PrH:'*[!7[Ihri@?;24N3x"G~k.}{ғe͇(UQ_]R},, ,@%ն ȑo'oY }u{Ur\w]׍k2Kabo("X9Zx-XPc_i7뉋ɅHu!F}9yPa7"Rj2";&`Q[{pjxS<3b'T\VMӮ lڱZ;0Y31U5 l]?ZDƢ󁿊.%tO`&7d4@ BSґA* _@ & &,nf&P(aPeI$ BD<,2 D,V,ecd޿XW1/AbR9&qȥH$z}Ou> ۶]|€ZH!%C@hآ:4ocgkW?i|$ QR&>\pnH@8`@ ,]uZ*K3ZiHw=g:xZka,%lRgS CfBץҲG|D¹?O9|Pw; lSPRDT9Nf3 8p|W;h~FTHp ^RIr/ߓlΩBєIHFm !62@/cQ]4"4A-=6ƣ>º%bZTe˸RH$Rl4zW=(m_\ vy?tRB]R`[*mܔ>$Au !&ꯧKL aeL~HX>L8MZCŘL7xcb|+QPPNWu=R򮾢7R(E0$@|_}{ʂQnd*-e)=uՍ>G[^Z᷻u*~-QcH`ba'mo=9Sg۫K ӌTHa#ޡl2Z͂J,xvD @ "^F\(\_ɗ+ۻ+ߞ)Ĝ9;P+[e7ClKDla0AtSzY1zZN5N>jq).uըyx- Dt:7Dּ!?789Q[g k8q89.!v20ƕ3o,~jߴ6w>8 ":F\Ekv JU~I,ﭙ#ា1LpH)[Z^}i&ƕVDkRјaJ҉qe'.;Ql(ϕ nJxHnw 3~Ӓ/8 h^c!g1\ d6Iw1)iaE|HA74h`5^,užVcPR*Lb'{E-9Jz 7e>\ OZ@a) $om7׺tE崺 &?V|K͝6[ף=[o97 a=+FoG?G~"489J yQM",ٓhLN9gУܥR:,!7i#YSġ p{?P4>>/=7ҡSc":!bQi\mX)F6`^M{|Bn_|AJs9gP[wjδ40=ID]P[F݅vhB}K:kؑxI:*ONU lmY8\cMkIɌr4) $̔8ϝ- CL^24}2r5w K4j+Owpǫ4lEv'TWﳸVM6l@ǡלp0tWq0}WRŜI6QD䮡ي$"$(&Ԯ,:OǸi|dE(HxRo콺ĉd8HQy1eSsƲ3;'I8<9&~*x+/n`HF*C)>s ;xf -n޽$ ""AM7vAڜ\SI}0PUd(+Wn t-L'E<5IR#;땇wEC;^W\1~&+\n ^6/,_gt>"萺'$}vTAؤ$XR(Xc(Ɯ[ts{&hDTnF#=Ez:GD;:D4x*Rxz0;սmh=9/DE ?Snj*%&he{G?q781cNȂPr҂dg BT;f=q/L_ k˓.dɲ]t-%kkZzZLu,yg>n^}yE4vLMƙag0NM7F߇[s59".ѕܜә|$[jP 0n%:@c.MVl1KP5H,v=,;Tc篨X,|trީ n}vH׏U$'`!3CpƗ; &?} A-J)+R6W*LZ2!Pb$HW( ~ӻن? |36Eϛ R0OGχKEDS.7pދ.^?+κیU; vp)Y&G#GߵȺ{4_BЄΕ~<Zdؤo}PO'U4C2GLC 6MN>bnIzHNF"*pOn)ʗ2HIX%[Zρ1[pWҹ>.3RowBYωRK.ߦ@yR[á#$09HܾFVSs'j% ӰķVͣӧ̲^CW3%GznD+ ?dIL\"R1]+%LOtGp?e;M@Ts DeaF_x׼mѯ >GI!$Xۂ[=4Oo|J-c?->gey.g1p|Hp?xN/6O:y^n련3Mx>A<|o KOUU{uYz[]owt7e%iZSE9?XoU#NBN%Y3#L )*Tϙ!*1VTRa6yn+d/=6,5e ;rϐNN4`i߾%1|TF2U *#kl2o <]'{\wO.7Ҿ y֫gcpT"X t0)oC+ifYgxv\p:urYy,|Տ8H=;/7"")ۙؒ iʲCm[r Z#$u/-mG0/~KJj&rnyOK`J!L$)tuMQGOL6vq\OJo]YHG )]!tĹhEG VU ȇ{*"bxg{Tff_T yElxr*) TZ) bi2l[QZV ]YģEm>Jo@@6N.WO[mKFKwKoqN`' 7| E#Iuz %7r$ViK:a_ZH8kwjȏQAu1CQ /&ӂCSN@uWS+fS<ĺ6 uT-{70q"$HR 5r6uHghs] h.d> >sؼS3JXF:PϞ{.@ݗ}*FQ v\rEtLe6hQy-*$ VIX'Rpm >YMy5HNfu٫5`WjfZY $VcѯvX*8E;jk%ڎpM6nꎾ>S #7ωM#\W",zi]`WRםifm].<`)$EC6#؜w g0o{__@)D|-!m go=Z  j c+ȦJHf~Jdz^He/vLո5돍-VNYņ|hʀE7EΒ@@D s*HH @1&(! @)Bjҗ"@ h`12 m$" 6H `"rبDHb#^P2&Tjkíح!Z>0L[qo؄ E3V=K/x~GY!}%n=uMm9N5Qb -' qspR%uՓWkT`)3ta, Tn]vZ0̭ ^ﵲ#reZ"!Ӹ]Fwuj2O "-n(ic=Vc[I'rXeeX,f0[r}濪=vNNN !E&Zh!]LV~ܗ/gh&A&)]xm$D#8[!\( N ʅoGP x}D:]nt a;$6P%Bt)Iy h/m);r|+MSR4dpISѨo$1H! T8^6-^~. .RJM4qyd]te2+N*#8<^LԜW= ͏:mՇ?FaoaV0܍4qq ID ݬ ϟ:(h !,0}ZY_ce5X7nus-պ"!L& Y==Aș.f^Sj {ݟgciٹ3G&$Шޔ9=- l7XiM)= 廪`G\ rnD!A@c :)"K n20#= q;_a(@@ 0Z3- cp/B ^_d8>e^6utR8iwOYC@)/SET.}F_ǼGm޳MUcf{Ǜ|ſ_\㑤CY"B.#O([*B27qr=CoXB %۵_l Q( (pwx.lpl,OLtn#U=̃)f;pϟFpzK7S,w߾5i #H-rYpӉ㉂JDP*8Gݻ$QQ|.\wRiSmq_Ey|w]:aG\|"%g=~m{cdx9If!d_C&j]"HV,cN(62 RF&߯JRc/*ts= PgJgGe֚RvY[ z) ac&j`oo3_~;y˒zѪeD)}~D"OUB#nNAo翲}ki+ta$:Nsmƌ>&&  c[g驝U|o|9T|Rrh9y=:Xkk_z2n,Mg~D@30[IO`1T28~;\ S4 |>M 3u X!&8u~?b}.{{_^d%KH K>syzN%M^>& BnZu?7A,; 3 AFZE[bbmm42C vFI`kW'3FC^Mo_eg x%u$HI14h b+l@ ;I}F᷾_q; ;0?scA[4(D`R1C?SH?ʝ<3vd d6oqpONuʏa1Jnz& #%RUEnQ%]J1^^W6XI0 )!iҌ_K'P-+ @+r](oUzk`eOp?d?TVe^(1^MmiI9a9>$uKO'T H$zq3#X}=ͺ]}S2/~BqX/biT^PI1rb`rY=k㤥qY,aA,Yo߾&N-dh$j1=^< u[qZfŨ!  !@(&$%D)=I" !1PII!2#C G>>G_{qyX>f*"@jh_e7@y:SbyO3C;vc6!| Ԁ[Pޅ%?t%$ kl"fa>?wWs3 π.u}?s7*m2Ԃ$KzNd5s'oa˲\×\ƪb7|y拉gV|VU l 3; " c.lZZ|GJ/.B.%8Y e_l+k\ו5FZ,!]orZA$g|, 0a>ؐd`"bަtVY54ÌuHhn4)EKT~أ}bʢ7U].vR-&_"]rxR;pA86>> "RJ2c:q,yho/Z{` poiUFUn6鯕 ; [Yv Cm t+Z?m20Xh2uU ﯣS1T^7>T?16:Lu,@^X/tn 첚 Ҳo!30y[9h)q/lg-$5݊R> S)fl|Y($E%Ԉ,(hlGAquJա*P&C,C;ͰS:ҙ}FV!MƓA"9vFRpJۦQ)ˆN?;pGyW#b&d1BcKvt\_ոPԕV}+*y9bpnEn Ps$(|2㺨e utfeۜ/p Qv'lau2_p`f0*\^I?[&QO5d/7Z2Rj%,C y[TT sU3X ZPGόrjw/=P,RgC⪋n*\ /NUԍij[jCf@hNCN>1/gMlԖ KP,|=CW)䨎W t}_u).E@(9IJr3<\kG~z<,1koosvPk\zoKډfj}M;mWfֻW}=& 8m$~O @*1MF}6ow[]b$,זf٭u=>Yɾsy<>eH^8jzކzk뢢X [ZP{;(~eRzoW=AR[_N-yРY?@~Dž`og eP?/~7Z}Lφsoc>"H,C>r!hYt|[۩%TO !1 paX$'"W٫s| nROj- 6ZcOWdݮ-%n]~=b)Egb1b~}2 GѾ3~3C0NQc^"('ђ@,q atFc;SWU?QmM;:>3z:G*}>q~s?y]QXw $fWl;-8ω`o(c:g0bUxp쿅xqە"D, Y1rD$*p !~q|UG%t%UknYg{9 :[;o{rU/Y_X8w'?[K^^yZPڮTD[#@ c=w­aT0l>!`GՈ6&H~ױ3}?S첾:?֕([cn6yuK6T7nR[}M[P"& vX}Uuj]k+?{וT>·STVq`0uT!@ #C sv5BOSxD=_n&Lf8d ~R!K60[SUX4Mg(d :vˣv9E*BL$u~r.|&P Od] Y+rN9ğwp}?.zHOb((5B(&9eFb瓂D-PNzXo_X:0qqΚP|{ st,| דB<%H…)~QܜVK Pg.d$^tV,!`~6r4#/h9# b0j~)%Dj/ᕊoA-9 :~m(.wr3^{Wz(3q75^zbS'}/LQM`-r1GyZGupw@ƙh2,iMh$ xH☽q]ZM4jmwHKymb@6iS[9ȖCzxwIY)ulsi-7\F,ZI{vo^ŻHlI\8! `|s7,3`a\GawS: *CqMo.X^әtϊ 8J?#2iaDo[:`YXrfs^Aq.J&d E @pA 2~ہ,qEgCoBEd&\hD T;3B0 ES7RƆ[^|ѯzmUDDP.d`:kvu|4/͏WD Ŭ25BuLLٛ%3:Tt#qœ(FúB C+-jKͦst6y:jhŪ%e-.3+Jۤp`#T1LKY@SdO3 Z`5wXAJ^3$U/~!Krߊ<3 ʼnPq8Q63*0{. 4G$lkҨСR7~/XeN+(Gi@5ۃ2e2l"F+{͡ m y,C",rQĕGT&^Y06HH^?yG_l9>6V_pK㦦<<(0𘚣(Zxp 6Ӫ{"5ybyLjHp8T#O@aI_q䭸#-n}]k*qoy FTʫ[h]VoI.ݎDiLbE,# o*<'$x\&d_^'ٵܭ?~#8O;lZjߞVxӾ1?HK_rߨe -2@yns[^8ɀtR_sASeX%~iΨxRI {{6^~>y]nH{ <S /=(vM*q$>Jؿ. 5}̟~ӘoV^(ݧG+3+_߆\I8)P  Jdx23!w&K2w7͇ʅ3ޣh NsbqX۟ֈؒk3b8\sw>Ä5;ZFEs}?%qX=S_B(!ӊh&-5fu$dp[@s{b]ŕ#}qcscjϖڇ4(?6CQ]-j3Qef HΏo01FYLeE2 bൺ"D#Dԙ &K{DˋՕ`M$\!vb@`D$oX7;?+FNx`?# #m.1`#"Y$+B%2i ݋۟\+ס-q|[/繎gi'#}&΃2z4ΖIfeLza:[C/]WdGs}KXYLLxHuqKF$loq;ƣͯsΤ_mU|jUB-n?7EJ,eMI $ F߫Kҟ>"ۏuĆJqzGPk%^46ZYX|/%䶳ia@nCk_,מ;=V\0B08 V!-Wh?;qaVI8WF+Ki[f~i2j.-.ςpzujφhoP.L>+:~ EeV[v^4b@ @gg33F8ɽC]o4cyN`ty P."UffԚm[=oٔC>ːбbefhli#"QZ@S~bl뼘WYȤ3~hw* qQ!]oUW+csZu{ K6B:L2p a˚e)(s0?QՎw;}L?tܢujPP/"Kr/c=Cɖl5`9s2 τze1:Nf{F?%^`܃SMM/dݼvŘ@"G@$D0wY-bӱ?ʫtJ`,F}Ǟ\qzv|5BWxb,)czp tb Β^vY`: 2n2@HÔ8@008`OR,>\8ý19[*r6u[wB2똩mė ܢj+/m:m $%^*A??t}jfOu$pHIi aD&@ hCų<_[rgʠKxFP8D>^#U˾0h@@-CJc61x"suq g)Ի:'m3Zjtkn%*d-w:v#tmp7]מvǝvHͿKPD@0ʱ2b*H,&T'`l'~oUG}꜔-ȑĬ FAՊ.1 rW ovͬPoW_Q9^WWKow5ex?ϒXnO }?0B5"D0:,\jZֶ]Yu}Ya"K;{j8W%C &J9zzr HӜkGUhE1}SͭW&zwbĹvZMF\j GpDW }Ongs rv>o|1SzlRw~-]cNwg/2ˌžN1vEG?C+z~]9ea.X7-c;bi#;"{Ѵm0~rZDX-mٶ@D=T d̼SdRG  JLAkfYAK˂@V7=.N@(rt&STg y aE!~rx(W2You)qið$~UD0dps.w fV` 20Ig*Sl68VZɩ{Vb(cݮС_Yr3 r1BL@ˎ:JgԝqT" iMz`F;/i.˵b)BYх-3UPf@ڔ@BX9q QJMir؆3 Co&We:nƛh_)Nf[?~#_T DEO$o.` ǴɂMXfޜXgr ̔]ҟrxjjw8$(@tosK`$dd2Ĩ qo0 TnV*ߺCjFo[lQߓR;` vKj-%䍛 1Sho)@|3 0`J6m#cOy4X .Mll[e;'5a*ɂ+Ao[D.=_XBش^3qKs#՞ԉ֕7=eAMF2zȾ;6 lv"E #QKU1^͙ω:~֍~{;N.WDW!SJ$!@;6SBIdEJDQdVE/ݖ | 5ΎCP5|8e#Zii^ 8F=KSGu8_CcR1aiO2Fk2MР}sŸ7G5;_kEHL*ĀeKx:6(y:ur2o3\oU .'ZO뷍>qr '<%(9+\)*h1!h%@ikvkW?q3lL Z^>ĪP7+F>v%x2*thK78XP^XĘ*EUt=20Ղɒ@!D"$pۿW#b>q9wJ`q{<cOd9tSN|dnk܆ "@,!"$H HH"Ȉ"a4jb5oa1IǙq6ɥ>N + Q9xH,nNw gBtgGVTSb8_%rC/0<׶m .keR_+סGۖkn[c} )I+}TgkMHն<* (D#HǸ[_9|mVs|l}Id@CVڻҶ}HOz`n=,[9nFIi G\b%W4.;;%\+"jVdio#]it1zmd*W t亣?ZfPS1v4+<hiCG) 7c{?Hߤ-Sʽwەua7͟׼8-9^ Oښ!)w[eyd;lڬ^"_C7n | $ 0?eEЁQ2$""H$"5JgLŻ{I@;v }<נzUsW~>3VG1"9n Χ/Bv97 M}@zTAM 1#rlL)x~Cx0QzБ$6T)E?>،~9'bz~՚nv8LXꋚ!J>;ԩim'c?᫋&P\IA6Գo6e<7[I~cs(F.`,E mVw1ƱV1y?W?oU/H<_-oY"x2ZP5˩>8#|Qyd wFn.njm mHG JЂXםHp.aQ(>LPV.j,U@:uS>N^BmT-mw,"MBS)} b`j(^U_)g'Q+QHѢ]^$)..YOr̞wwgY{x!AXZ3$ N"{CJ̰0RUuu$tJB$, @ \4(H@s`T$  !j2(}$ *M&4H2p ( S&5E"R! 6 T$i4ٿ⍡f<%*ڒ$&p/҅ZhLB[}ˌtA *Bd _{!jkb'yB)i2])fO*J-g"lWEvFzg7 -ê?)+JJ.huxeCv,.~(IRS6p2iCH; K2u'ٕ b"+w"oOq)dP(BEEC[ U^iBvq%zE)S/WKUS|y7س?|7w/Y'4(y-,PPPQ@҉kk6o\Y$) EDn1 vV 1"@xهan(rF;!҂;ӯ׷r©S/&ޖGPt?<-{}ͭS܋rʓ|?ۃf͛6mj>տA&a̵k6mcaV4rgιJe _Aηh0Ͻ kë &Pn]ӻ֚,ݸVڵ-XgׄɭqZ:ۛY%huŷuݻr[y)Y]nYy}2 lIo达Ӹݻzm^v_FH4iv3Ч:mjœ-V@d?f=՗vԔ).$#QU븸80!բz>pJÙϕ^oj5מ_x"D^i c񣄐pl)@k?EGts>L* -oc{ݖa9j%1G =:kO[Fph]9z]:JY`vv׷B  ^?3sb_&gZZ^d[?.=E,|rr"q hγꪦStFO\W3^F|L-}XtNI0#)N΋&7{o=ͫMqQ;ݎ}o=?RJrͤ߉PH RAMtVlԌhl#=wc{hIZAJ96n'>ވD+<,'J.bT۷s#fU/mdghsJ5*fe'\4~žwVJ^ۂ(W IﵯΚ]^l3y_i(#QQW 3ϸho\(#$"q]Lnq:`;^z+Q)T'zC(}}j*h$_0|f9&?y'$PC0I)@D*m'ZK-bդݎ%,Å~~zogm^ĺٹ~ū5j5&}]ULHGp[?ׯ} p>t'ԐOkO*vCHdAAU,e%MRJF>qR{m;I`8p↭ZujhhMTh;VvrEF yBIE uz-nڝĬ 2qҤ6M_&wc|=y>{CWlV"?L~ @Կ ~ǎ~_eR Aq$߻}_@èf=,M3H2T= LQA%HSg5|Ȯ2=U#Pkl,1c e~3] 9C|{B1eR^+y;. e2iҝ)wT7/Wߠ4#0g䃌C:oE;`}ߏ t]]>Q$̄_knޝ /u.-0O 4'zI;SF7ZY-bnmkpdU}bGW:-~R9xeNV[ra979~]9akirz DahGujh#0dyU2=.ޒS[GNe.k4fC /}<7=b:d3n(]1q#aն9HBvI6E~϶@?LK/m~d1T; x`l%qԳv@ZthShݚ8hgr)1B}8(I0b˜ r\[:}_)jQ?耀#f:R=8p*}io7?w;/~e}̥B2uoC{t;C5S7(=wTbҷL(RnUR@ 8ގ9 $"U8"çU ==nlak1URy3֚ڊ% ;̞)ynғ"|2c\$_.k$>:7R WD9MZG528 X/Mbr힨n !,:#Ā޺OcL*?5IHy U<~Qf3#NzzkG]-}W(%9Dh78s[+ 3"W n>;?^[?s}xZ?KR~v=OUu"<G_(vww3_s;~1eLG\ U?Y1<.ま\^vfmrg- S{)w3B| NhE"@%W%idҼ9jrh[WeD (O GFCw+vSpr#6y$sݼǢK?@B\=(ƦP["J67)p? X|(c9^yXC ]_M(k 3?|5˞jf3OU'r/7f}rW %{7s==2L~93r!!GШ 'Zin/oXq"MֵPR7+ԘA|saFۯ߭> ᑎ.(ZLoNw΂pf [2[u?~wR;J ?;ϋ}o+; kGrUK 3XO19ܿGExM4sFK+1  k.X|nL!v9WXIIF_NV^ @-M.>iІWĶLp[ -eym?vR~i]. L@8 [u\6ːϸpN*zưs722EOT,.cnޏqxk/9>2ܫ6Pfr2,u26ALTA#fYnJ|GL4󪢺Yk8dPO M58spKW TV'4?k]Gg.==( ipp!f H:lm 3u]ތ Q`"WBȳo$l;hq,O»l3'g9Á(@0~TUaCfN NM!Kg$QN'ywŠ&'SO\Sއ {!GPDD, Op /ĥ.`eEdtPG.ty^|? *4gmκ0\ӸJpRV!)0rL-N`m aWKA D5q͘HGGhn3t{T{GtL]Sgs4%[ӶWFuixepVZ Qd; +|؂Yh@D.u(Qc_S7Eq((:}Li}^"AGu/C6m q-QqQ??jS~N7W0eMxm"37c& ?i-~~3]c&A# xcv[?:/v}f `z6Z­Tyf3 *^O_g(WZbt+~CۖwXo qsiB (}54)Jk_%4(PU6KroYž巛V`9N !P]T|T_Mz_rQb o(ʊ f|\kg}Е}&h_,g>V l$@()DDDN(Mw;/RlXk MڦĩrSAkPFWO*Ч‰Sd94G9 >GSpt`yY'cr)9{.2 W7 @ T2_ [N/ݲjy8\epyiFWP@Y!xͤ.ak} "u>6u!bӣ+$nŎ2pi \aAh+U~o`==|K p.'0;#=[uWnW.>})P=b$Y`1qA=%ud1Pͳ;<Oˉ9sj x92ohZ]ҖFޮ cLeJ8XpBP8m[ʪ)62!J2}gq8]dL+0 pؠ x$m ȰI D B=^VKLIyB~; Pi6R SP61,dH kLʊ!I-DD֍qn{J!IKܑBE7LI!sÁ%bk*R?ɺ$t +RӺz" bpAiLN7_{p>]?q& ?t,YVr!i~R?U\_{X?3LT|AL\5aeyBDv*\fz?ޏ#6@zJG1ՀWD@'iBPݎlso9/1}{&}EAܵp=k$=o1]?2ݦmz\8@@DP`Dߵ-u#|Ǿ֏D]ָ>F𨺑\'vqxem&Z ??8f{VտEu컌^횴_;̏bӠѠ(zngaz!|fr\+NeP9!^sOxӗ~U`>"WI>;ޤ%[أiV$D ȢAtl/m{+g e'Bs m!J8gxD`L-A˧!Bz"t~5Uޝ|SiBM~6!_#9PkU Y⬔2,`=关vstj_ͩl8t.2:괣(Hg#^3iZъLWm~ P0)p'e߀_i鰎<[bk<<]/zIucurR" je},տE%dUzV^,;O߃^S}F0:⹴ՌQ+2JQQav/630j3%m?)YYZY>gkkP2qٵӾdy;՝fjȌn!GFxe|6CnfmjתarpKIjm-=Vsw }E{"7|\귚EQ y,"lkO!InD> }{=d{~w [8{B 0/fYN`+>*+{5짵+ٛY&j/}p6l7/Lr #a/ gWh1M8jmn_T}fȿ(ŽxǰgsVѬsx0{ta90(WE:%elHPlr9 _D~TAu?_>o~k(OO^t47&Ix E9rY3G|Ǻ~6OdQ.wmO@YNov~ҥ2]Fɱjѕ')fi ڹWz͘otiOEw*˵ 8:`~D ]~gߍ I9_kޯm&\5} dBo*8+'`RS~FnE|t27R2o90HnŭZЪM IsC!VUMbBzRwټ,D{0=b@h+s-*]%E _SwPK6uV]]2(9OE?;UQY]4O,ds|7k=KA4_Jΐc0^+L>X~dĻ` 18a5G4㼽6@<#/Ү~D^ʝ'EEQ}I#A(`(A`]&;Ks !{.عjg䍨V7[~I`Ì"e#4TzG;G$T,E+s? W;L9Tbŋ+{ Yx.ۈ1z;gRdͲCYѦ<ӮWۂp+",cD!RYćag1]LTZv7tif(=Ik_IN3/~Teӆc cwPS6@@A%c%H)T@GHtD 50@oij&ccQ֩dSxHiE(CJϣ! s x:Uݳ̒b xx.kצYQ гU9s{Tp<]:⟼~ 2MEJG~>.=o;}4-kVGLv$xi|J'tm+J2嬪WbٙJHVNamp=ݪ]=:6zʗhʻDjvVյs~)QV_0FوV))P.}UW6P!_B  P  H19lFE?xhU!cQQ+l8(x&|P9nVC$> mA𧧇\J3 ^3Ofiѫ6`AZGS{AO|)dvg4 t|nFPj8金:er. 3 3ЛV&bH41Q S\Å+7{mϺ:+$A֫y3RLivOan G*ajGp&EnO+N h&[W(Q[d—I}ꋘEh}r|aejIx?G92wu~ `:Yy8s g|}9.URi<"8c&\t3iכ.|-}v V*4+/(4Y]zҙO2տgj/}H1aR 1*v[32.kf\ĝ7k62~D 37(EIEQ;tf>ΞbNa/Cc|iW~_qleZ WWrA9♱0 9VrцM-[pbD4mK3YN?mN$,^g$b!lz{sS:җ#;]W>r[mjdڼ'ݭ^]cM_΀.PO/)^ 8157ܼуN||, t"*_h9(4DX&'eq\nEx7wKVsWeW4z.&o]:Z'68֣44]4'(#ḇ]WRpe̛5Zq=bd6BjZr'G *'gj*#iܖA0zs&SlCWscQ=U,X,&y-;Πo/&ڀgpPxs$:.~3 5rAߝ.kL5w"ݠ̵,93BWw0)?{u#Z|- 741Axej%:4P%9Zw{We!\|("z[QHmi \I]*࢕K90GčU)O!R~L\ٟx(d̢6рf\.ϡNΦJj}~)ԗ^|pObi B$ *@ܾ+:jrw pV灿}޵Aa4y(jl_&cQKJ&H2pɞ7/]%~h{A=tM{84W{5}g^AzGUr,甌J^T_F>/irWqo04@rJ -YMtlMJT|I}OVkV|ҡ٬\J:^Ҍ>m”Z}[[Xy>sxgb^+xʉ˿-0츛a|Z%Zq-Vf6q_&>ȍv~>d:͞u@?{+X7~!==#7IƎ-41-Ws[ֹ2SQ[MùW^m7UA@Ǝ{vd=JB _wGSk1syآqp2qog6D8Qyo0ӒUf]8Ѹmg:YaϪ7MJ/1VUm&B[ ̾f>G;1/ӖZxNV[q⭬]{uy֪Չ?䱁ѹ}89zis+%LJzW1n 돯٦eNu- ڴ-Ae:}5{!}RUW0/Dz`HLۋ8Cr 嶒##U:fqӆ7\r fk{-8ROJJǠ|&gaT=5 8] VXi I]bE+𡷨%-MMO۸U i>뚄Wuُm:ڎUdC s11zum HN|LUj21+WY]^Po%[Yuֳ*wN˗ r}+Жš.R4u25 ݱ5δgcjkVk*UvRgwAa>UdKb1n8RL26.~\s}0@q @r\OaP(c^7ʧ]G+9'"{p=Ѡ潄X=+iB)XO9qWɦ:lH]=*ãS-݃NET&bKQ-UzSn7>Pռ:A]'w)N=<$3Gplof~7eI j`P( K4ͽ˜ HHK 0H ⏋A'{뿋wpT9̪ɛ8C8R|9C7]xFc\l*Fc074`9].ηkrݗ`νߐb9)H&{(O5$tߝ?~ :)3%ϻ2GTe2L; :?4;m;2EoqYY! ٙE{2Pmj+klчUNݢB6VG4?ԅ?6,ۋ_L)'h ˙!ښF@EHR =4frT[QR~!R'[\صv)67?БN>ZXlMЙV6-YjTbt(sEp~cSi@=Z>t_Ea 4q&)&;%k`qλtmv5[h&Jip#BШwIAAJ4썥H,cJ6۪W{ViZCe+wQq)oם댥%PF.SK>}ųVi5ڵ * ؘ+JZk?&k76$zmѽ)ТV r~ yNӗPl b2-5r zY Գ[`$֥ }`gc>*nK88Xv'Oz_Ia_egA6B%0hV``|ג=]w8q?zOA_UWC☩=d=1O ?,1I9授ip E2u~&Oc_ڳ+ af%9gR˸]026ס _]b"ٽQh֌ 3E2`ɱ҄y{Kj!!Dl$oG'Uz+IwPdP$eDR3WnfX2RY^? ͍s>s@bu e5|aTDBC<C=Mfgxx,jZG&l>J˰8`F@n!;p쪰j߹IYJ[5]nq=ϩDlLr:|Ooe }fZ"x͜w!dW^`ݵ_ӂCO-em螇ݽٻ F5qXxݝ턗~EsB7i)<.' ]2C׉~dCsq>mX7v~3Gfd@#M ̵"hdPR&i UܭЪ_RlIF[6Ni_Wr_m4ϩ)>nG3of?ds!$-t޳~Oh9GXC ֠46iZFۜi2(k\vWLLavrΉ}[2'` qNK8K>Oo>OY^hN/VϨT&]4™ivR6'ϴȼQx +\_?KA\r554u6Ν:bUE)r>mrԤLs|FׁECQYC:?T 3`r#CSS_9N(b48A!zSjX@hBbm!"c޸hHN[Ll`4@`1 LlLB%V`CQ蜣W0}' ~W1ykeGǧ+h ?Eh*wdIdɖiۢ\'[_3+!6]7y% ~jyGJw, cm#s;*eR=4JHN52XOA>K K1/#Ij˽Oa; >JΧɀ؍/$= o&ȾNUzBœ`U=9tʀP_*tD]*0F5,BWￎ)xmK)EyPQ=H+U?':cA(8 iA];۷2-jkk6uhjg\\"?SZ4tCbwW6U~7P$XA܆zJKUXU[T .5՘c$Is6KV'oZoŢ]A_0~2"LӠ\3ދwIf'[fҒ|,mM7GkFHV!CK, m,@oDZ*024`?_3]+ݵ<؎JE 8݄9P1šʨPFIՆ)11ҤؠZFy;l@cV!<@ڄ/BwmʣI." WajgսO6n Ѻ ?̧Yaֱ*(P@"2+"R`!ts.R>R\-huj24K y( Yuvɰܝ&WXA>I]?E)Q*G`[ny)KUJRХϳ$7ܹSdC2DqGR^HYcdS 0/{N2ט"*S*͖j9K@]2j%![SE>feV?5ɏ`,*,d9<%*NRqld TA]Q x`͂H'5wABŋ-΀y8SLnAb7OAo+ep^m|}9U !nPL ki4!:fulӘk mhpEд2t.5ĥ ] S8IS5Ull:YJ+S7mWN#w\I1G}Vj bT:;^͙janK)# e^6nuuxhմu1"Z`yL'շ ou$kDWr-A x&Y otRP|JWzL!FYڀVf?qv=eKv@HT ɊBh}YE_:9"7`#2Ce+ZNqLC;V ׍ (d~ߝό6oJv WVXf+w ʥl˺F^* K̻;;w`ExK([#p \9)eo@-*%%5" Tx1D"DАKו\\/)1$yT,YQ5hՊ,#) nZ%]uМU Qڡa^U7nIfL@G^s! A($!!YYQ"&L`! b R\ B$BKlLJhBDBhH "EʣZCDYKCU4^aʡ d6$+r읮l:,U&!NwH\d蘠 9mK;xxn@"h%R͘]j ޼hFX;4X 0Rw#*[628g 0%Wݑ}7c HZ-pHRL||IT%*c=ʑTa*Ǐ(̺Ẩ`yUDE&>1 _ͪJĢIZvӺMץ6*h4gK\LPIn]= tr+:kؘUu [tE;aAHS\H;9x]dSDf[ߓ>-p_gv8rYzm'Ɇ,.O: bCCWVCth([(2e9Afָ7k 8)uDp؁8HD }@3[3Ή$7&#V3EԂud3_͂)pwhX:XW8s8$911-|ol?j2/+|9@{}ϡp ]~ULȒ<^HgS7rcu/1 !6 )ع`1N)3|G-7/i4e9K󹛛H w#' | Y9fec]{-.ҥuB0bI$!F2B2@@"WCJM^fbM>_v|/i}i1xO.Vħ:F|؊T^kR 3?Gjq}|_}?w+-j/}M}| LѷY^C}x~[ HY J߱(|{[>oroy)f͌ iT)5z{ȵf&4+$$ȩn9:1'|SJsHX68pPJ(qb2gg*@%R ``{f]7UƆE*LcYxtECT`uiH8J]}u3"ι`eqsRr3Ӫ+bɷuNSx'S7..>{B叟>ċ$P޶OON#T]]dKy⹄ ?=#?9 جoB:)Ǐwي't~rRy\ATk"h NrZDmje:%x(ETĵG ˴xV_/y_5͔fD䶀@ W/m^vYќ|yβ)@jM"?7Oej1p~W'0[)D: FSq[-8/7zՒjYg7h <IDK\EID̠?J(̘Jͩ]eup&t<^~~,:'iL޷ct.*߽=?֢tV.|"ۓ:5lؕ-S |~jpZ,Aw@~}ڈ4Cek2˪Mrs@FkIv{Dmggpʅ^,U@dUup\[<qqqk,ؕ<2scZTU["uuWaԪ_tn.4d--rr9N|󺳈776+ND3Kx7ϕ&ڟ: \ k IɄYYY8'&umOOO[7('g=m}WpWWWW|8/-4ngXXVXY<G9:h,9 N!@ X&ѭԴ~MОHlڸ%F{XYYZ[g)W޼;rrqc[GG\o$2o5m=oMs;0R2`+ 2Fdd`F.Z^*K=P%_E&<⦃dӺTI;"y{NnzMIɭ: `.v<=1e5Ϋn 4ؾl}K^Z{ 6?~ZH$h% ``!A$A$$]nNR{Y.u"uyr\p> !rո2}ˎ#¾h\)GǃU|uLfv000V^c201#ccu֬GǃGDžH4إX9<=woc}s;( {ai[ [)?*)l4cqmJ}4.HQ-wlRY.&-֓N?ØY;I7x7(P N%`(vwk 0H%{{d_vϊN|տ#TTQQRN%8xgeT.nncV#eMi!Z86lG+GG3pGGhc1z18ѡStlk:JPήuȨUXȊ-BOjr^q9@ಲ2ef'})W;:5F0! p""K5QHDă JV.,f=PEV^BbhΎ/O~_B;KF2L]®Oa%hRnnnqBYەE0vvrki_b.JXPHm-w^};* HH|x- <#>7M HHXHȴH;;;>^F^Qr-|TS{&aWaackZSVߠh_XB3nd wԩZy߆Hv]Pv"m/ol6¦m`FVF$ټXLȆ!t|LkfSÂQ.Nnt*uEkkv} f,e9k]E[b672\߯Umna c 0H@-1,"$;T#a))C%===k֣ .Ci}mHcyk8i7''+UշeY*MmmL$+ʿjZ*9M6|=@EU4fi"B,"|.)hD\[KHET5Eť azzl :>/soxE\\qqYqUK_,=<ܾKX21vr28̲R*]6%` & ( 2'&lerL h &z)-XɎx -̞[5#o-Y  J"A=eXeeeeei#SCŽ5i"9&Cv!@TTS:|S>;! *B agl*C#Jl@>cgg;ea[ay)!{A}RcO71 k{:1X{zKQ_Fדg#19v02"7'qnb+g"(لc(JGQ:y[Ӻ̞,GWsb0T4Tݻjwotjx\OR}yCLdqqs1%qi<+g>經tj,.kL{nwW?7H** sq{q"l  7E@!ǁr|rMohFTjGNonfJXv{H įd!DSK\J+ )lQ:55AsN %sb8 .pf#B}U5|T~KN9ZWWOZV1tqpoAAA?{{||{Ъ2FGq}> =% 8%>NyAnuqmix%RĔ ,S=ʄ̌Z[\=sBfCwٔ|%tXJKb[?-ΗzK{cS}V۝g-> nm:A554 &&L&htWb(o? urᗓص@(=YQ2~YVqnQQUlTtu%Ą~100iɬi'xdDȫv%qYYYYMgU|6cن}=nF.***)pFkԯZY?I rmme4qv)ڠvINNNN>L$ʒ&L$NL$$d$4RBnzsSyiidb.UI)nͽɷǴ26'4VVp!%!pрj*C„,*֥F&}4#@VBX(-ص n}swiwhc:`=Ƌzttx':5`­&\*+ ͽlTEBAg&oV7_?eqnYQAgDe 4ڦJW?"Y ^XLo榋--,OO23:ҩ8wHJkf%wYy]nexa[o eOyHx)";e!dtq G6n}N]L~~ 7=& ڕ<ϬKޭ< ]η^ߧ3^6u'cv:gv=+U>KW3'}1Y?AaG\L[[PՉNX\8p⚃)(-o! |1+z(<>$aPm-$3:HYl!3$0 ! *Ana$(DRBҋ-`^?GKh՞T (k;ZhuM/`- EfSSJv4'=iCT:>We>̬UjUVVK@3B/>{H|T?6>jKm\cL?,¨ʈ\<8.n!T騖\qdoG7:ϸ*B֚Ui+? U؈#MonjꊀTQSo˵ǬTtEe^eB[C@ k.[oi#ԥzritڲSvݓ9/C4rrᅘ rJ!aed!;'j߄SJ~#|k2x(޾ 6[rmva[g[@#0~ ZHANiϧѓG뗗s}o5ZXX ޮ_=4 ٝ#ںB'$'''%̛w$Tץrn:ҺHjhhh3xA@ ]ue {,R+pl-}>wo>t` ne7kl퉟,nJ] 4ZXU*7ڸ++88N .(jrjۿdAJ~^A ͟Qm8ׅ 鵩O;Ҫ$A&f{'OP'qr۪&PFKs>+*VT!94Ѯ+. ɱJRMB4`(ܙ7n#2jt.r?=z #gvpD8 |ta\Ua֚MsX ^$5 NdL4=>{}E'fuEZZZVw^B Q㿲0԰hGG::::hG] !:]vnk!p~~| l6 A:T)w@K?ZJ=jNͩ;;"Rԉܹ$פ$0+5I67t;[&L)R@l `4gOp9>#-ؑb8: 4å;vB2W VALDJ c66662f@f:ԳbJͥVmWCut䶉]0yMVBSNps@4in[?ڌ@$lg':f|0saŢ#7j ?=iT.kU`BDŭrGL.fZY^S_*(g`1PQ,oԤ"˱LyZ8."i9/?=}=LMu&n?d9҅[kv@$ X?|gkmvyw&G γ/@+4vuϗw4'P9H2'@`n ΚSkq}Jם")ΟBV'|bt?ITBc嘋e[oNkr7Y $ |F@B lhH  @D(ыTBR)_BĨ* ie (lZ.ܾ?s37!β`ցjԙ?NB(N\_` /8Ánԭ6]ثWq^3h>o*I6-}+҈ ~wkTьgk[@\KVjpߓ[DC^mW};M'n|ZC3+wo.) 3CUBALqט&O34>CXep@ FWU< ;r5}{t}z*P>#w_Cos>6NSt 4SUATmH~֙h]G +o6N^ktVyz ێ\kJv"> =r9HgD E"&oH˯_mOPPy>h\Hw]x7Yy¶k]5UAWgi/SD,&Z?Q9a7H}Lv6I3q :<hF2x8&cFgԔugKF_+xpIIBzH/ˇ^B Q"zv?NW\Ƴg{:(~oeVy z9?*~)+֤&_I# "K3:8lLeiV#5Fu6auauw?c8X:\əj`߉YT QIgTT[4*}=^FW>xOn {+]I<$ `OԦBf)a1ى-$*Ϛ_CYKq67 oz+ua| $C"C{0~_|灡u:$z>گ5!]v^6͈֗( #߻ hHj"@vu۷K\%Ue[B鏿AB'7 << >7Ë |7 !>8.oO?yB>@G$u>+z=/P`܊JdC1]/.Gݺ:B//.paf\Km3@:y+eG߹7qd|ԖRh9_OG5{_Mz\h/E5͒yˬ!y4ρ/Mmsv08;{r+jQWemwg8xu"_/V/Υ.]\ 5c*_]/S/F/P8-mh4aIQSߤZj(*Xݽ*YXx->~Ͼg7!&)LU<]I|,!h_ b!G3h .>D~( MIo==}#JݦnYs LMMa\VPfvg3se= N LZFGsP7'p*TDP顷+XL&δ=Nܘ МX,k'8Y7E`8:Dk"1"#I3GI3w5 KRR!D$. BʼTʄAB'|@P:&V/͖oN80[rWk*'lKO5BA"PBB Bt#[`%MVLɮ^}U:-B0'Y )\ЅoKLJ I6RFQ0 AUYL!&(x pA0AB)ҩ#yX+ Tezz T1CL*|4QFF1 -07bpG=>  J$Lَ39HCtR"%L̈ ,Tk=/Kuڜ?yB`sf0ޟQNZJv8g/!&vqb+LRzv0 YBqC߭ἡB{z 3cǐ=osiRU%5oa+8pk}MicCKb4'-|'ADnkE앁R/@y_E H.. ^D̳; 樢` (%0d(*cB*J 4"$la[rqMfUrQt^C|{XM:3ā}>VvIMMYfN b7=Jp1ڶ 05{7(7%{I`fd%)˳fh#т@%SDm24 D#5 g7bqU1o{d4Hb8-DQ5y%{y5d23c7oM}wMC{d? RЗJb䤧⩐,rŹf^Z^h 9q*Je.e6SKCQ2YZk'w[d#CC-SG uZ6V`Lڑtr͞#XJ"E'KE8̋|_fY/Uӡ'?L%%:*~Fm=\ۆ¥@9b(wsx_SCNgD, XEw^s|yeQVL'.*.83A9$ R~v)Qzo;r3osofԘ4-2JLlZZg򸐺uBfbg67QZ/'Y%'JXAaZ1a]:EסneYyϫvF_L{S073WB!9X-oHR)R|&ioU&@a  H3Qr9#\jk E9&KΡA|%BA! #e.X]WnN34sN_wvjMz3W}2"~H7҄xTP8K*]co<\mmmhR1dV^\ 'qWa\mk`Pe)@ @>r'8Pg9P%+n>]<pүlX <-ǁ#J4Z/|p&wڰwE+ ?YˉsΐFfd&97Y\ Ib~\~НJSNn"*34ŧ2^>(uƍmWĨN cMOF7&bޏuB,’X-'q`pC80/N'˱:̕ʀ79rCNː7(^@ i/$$BCygԓxmŷ?-xO[YN{?+/WTP &ɋ/D!P9)"C U|⍋\ cH{3NZ43j~CmjG50BiW*5ړHJT+,?oRǁQB13s3~˟z0d+M?a˹<_ 'd !:3q Վx}jV` >-@rTPaKf#oL3(@k58}.-XRj6&*<ےӗiX/W hJG`IqXzl덱 >Ҝyh~O:ڳ0EMYK/G@/bꙍH=(_ˉ`*O/QnsRS3RAwO`oնaV(ֵp^v=s!sB;~=j)2ҭHGeYҮ%ti3(3i( .Ey%0pzd HҐ^e5;ϔTɦB޼ CZxuM&{Iw*ퟶjf1+$AiUvQUN"Ўd8S J S+fg 5Q5QesJpAtc>soN:\UR}]jrDóvRTK; dƱ]Ug[vmLTtm۩cRfvaɨu+-t&dm\ gpC+K#yW׎M/Wt/\؂k7ӗY䉍ibߥ8%&V;Jͬx/ ƚsxvNRc 9^;wq|*['hS/u:AT]k ]xC,%8=j¬RS33Z.`U+YJBч JSI i 1:h/ڿ~rݘZm&6Vuv`H8Z [lL2ERe]QPH"ApxYI@euŭSj;}ijl5Y&MIm8GL,  +I+ϵOz0E{K7kN">SöH\#25T BX޽i/;mdL2Cc=871_x4` mOPh n g_%{29=`(H08}9߮tD1SԽO ]'Y`QZI6KwxHAstYt]HPuk*$3ȥ˝t<+ﴅt:./NؓqNRغg+?9 lf|'Iʼnŷo%eE% vuyF^c64M8ݜY dctMXD.ϟ>b"]jt]k8}㦎*٦˳QW@k<x%N]iNh⠎оECIP`n'`䱜,U72q{c;`C.JuM׵e'(ױކ)8 ۾|@p.z}ͽu hCq_"ݜnbP"gJ`Ίѵl澦Cc mlf3wga4jGorRZ_[o~_+9ܿ){{Ãg ;[=#>S6,;w2$0bцʶ!&|kS|߹:Gfo3)cV4UvFNku嘸snFQ@2(*;\qY+Yg/Bo)7r\r?T%5q tsPTӻ^!}tlrӹs2^PٳA"ިDD;wg_vF(ŵZ ˋV <(\.w_q R)=TcQ(߭v>]}̈+!ZlBpzX޸Ҝ^R1K(U`sv&g'pv`n0൛ves75b(/5Qff5 w- DA`BBbM S @DFAd YIJd- zB 6>}A2$A b$JnNAh!(b 5PDէ#)"m5TPq4p)m븊iED6Cnj$Q+񶑁"Bn<kcU'^xFΒJ'0*#>n#ۻTP<~qͥ_ 1G@&Dq>!>c&Y)@e r܁("`VJLqe篸FKG~4 #-+u]2sΛ1t],}`WBǏPZ(GONT.1ڬv,ѐg Z.t[$ V}f2T.80P /iw:gU'*s}Z}n%&X$ Fa\zGz6Yg$M^{K0u}C*`i<blqӝ L5s4bϿdvzUe Pԫ]bš=;XoNE8p}m&w '8MzC=X@"V WF%fĝ Vʲ{]4(w"F}~_e0xnni9IxW7\f8r,u^z7&~gCo٠BlPpDi8ԈC݂Xop؆\oC9p@@O :r"J/w[,7٨-vB( d}G$˲'w}XⲢM+ jSd;b(jK%5gw*!Ը qY@ \ Xil%B<ĤҺS$^\)ULzkkr-7`+DB,jMzJJ\L6:ThU'U&(HGcuEW"k7Jntȟ6^Ӱ%H ^i༢gJ (ZА@̢OovȧUd9aj1{Gy-g*%I&Ʋr92^z)K~ǐ52iE痏8_/}O9lǕ[ Oiͫ (i'yaaw$ʟN|ַ@h-Cnn8!FG: HQUR^d(u:/F'X̆w] 4*̛Oi=^_ eȒZ&!>hr< /Ԍm9VP5a7B!C@{$t4H\fˤ #&0r^ :o?Ks[q "/ZI :괱`y ӷ-DԞ@ }e aGgYcO캧lӉ`-jBEJR('HE4}Qebݒ&(\,4¨F)"m:`A#Im $JiJsU&ZMԐSbn9V{}WµΥՂ_Y{?uLNtDNjQ«-݌K FI܇f U,ns"G-nXB;^fo'ro8:̿R,('teW2"5Up"Џ P.pLe^S)zєi Shק^usc^s>n˞ tٲR[?#ot<,C7X ;l(n S#Nzc&UBwWtmGbEGWo8,lB  t##H  *mrtP} T ŅetHH`IF8tifSO)i!f.L`/zwwH8BN ga_ьm7/A`>-iZ0ZtϷ_˨{B uՎN_$t1,rwP'-Ivc $^/k vɒ*{*Z׬c5+*?-8[,>fkivZ}K/=Ƨ8gOD(©e d@2(wU OT|hTmV{31{~?F=͢|a&y>ɎwdLnKƉ>Nb  ]yhXOp0t#"eG,̚~8}aQ{5*3K-2_,Qp@*-l.PK~$a۴dh_+푀-,Xy|8C15Ol-$s9޼߾n|v/s|E)8KfBz,^WTQ^]f&䬬e9odV}W}e2@0)}Mgn[}Uw9>:z1eWg+&`RerCH_Qt{:?\_+1%ȅ-8bwac7?׭wQux9P~l)~рJ"TE ))K<`Є[x9c>[f6+Ήq~t`8 kBp )T4u=t8:kzNg~)#D'}@sD;xXP<_.BD*d~p,~2 ^q:'/vәQeT<3X0@ ޅ< S(=᷊\ߍ_ >r4KqKVӶqȭb_rQ&IKK,l4ߌ:Vd|IɃjS=Ru6k=5ƲFUu9e~h nIn0FJ@ &OÖ,p6-%Ƹ4K5S*d𰸙ԇfW|W 8'bl %垜;7xtH[h_G@~{p4) #dcZRʁTWk j8dtMZý~H=~LTtjj,1)ˀehۏt>+Tcyn !^w rvKlj@A sѥ'*"IHJ폥EJE&(? T^wd -IХVCJ" 킩&=9 0X;p)0/@6NaNڟV~ÂxH BBpˍ_Q}ʤ;7 \挃Ӂu:m@ JH "%a;#q81[Ŀe|j8l>\嗫Z,{]Qz t yԂW϶¸aysP%9!GTX^}(ŸQmb ~JTw^u{S;pH9lgygIYѷ6]'7WS~*<drq _DX y&aLn4HD +3j*zsC0_\8wkD+s~3t:g_$wݗvs}t}%ܛ2 Լ =dqceP.qkEB.q?>vbX:ѫgy^ytngRϳ#֭_FGͶ1Jw %O,Mx`tH7u)?=IFӣ|W3+\6Ll7N]e8lu*~}mӺ@Ol_]Wgio@"Bn1VhF =^#?v}~:!{wƞڽx{o<1* Ӂk<6-¨6 祭WU{9ǿ "wob! /C ;=A8( 7Ix$Y=4\?Njw_Ꞹ"b[R ?w5z|ѝmg޽(+%zé@q p?E'ښ/<~_|iU*|9inDHweq:}At!n Xcۂ}qG򾿶>킪T_ծb7|z;s:w)v- )cW2{+c6C8 ҩH:&)]-t̃1 Bb!8 ^wrHzxt&tK19.%hm+u&%oҧǬcypf~> _^MtG|BJ$+G=}}S=`d 1b?%bƍ L<9^h|~<\rO ꖞIT3 `u{n~Uw?9i?aϗGSȱ,>i̠(B  I'wh@ /UXRFPHq rod|߷*Vg2L 76NE4(Wk wIjJy#u5eqJ,Tm60d,j(J+dnBZ'}i*`,?SG+}'~NW=~޹KTg;7+9R/O=vWZ8*o2DラEƯx|( CAD<=,!.\rF2! QD? J"h kr-I{i=^,WG789)zBJ$o'(>@UqUrg5?Fzߗ~+Q2!WK1EO~~Yω^~In\ S3 J,9a cFW2B^ֵŗ*=ty,w_mfӒxհߐCTz#h. 0E^O5yoB&Q!T+V3=*5Àt|(Z@C>[ cքr;G`NIHUbBa'xQ*0 Su17 #'g eU 2H]GѮ`sG ]z%ʯtA:3̀eqU} n;O2<(XUj5㫉5Oc AdE`f[[xH l-q% J8?RuBqu()7pgCzt8Xgb P@Bg5\)L>0\ $wHAvMQvNۑz24v3$2\JVJ؈!:&8lN@tH$ X;;b#|7{U~ktc+Sr $ <:p4ͦ3ס/x( [.[ђ,/ψ%u\tJ%Qif5Mה_T)rA 1%k>T Q^\퇝ӋV t0q=M!A .@<:?dY/}/[& ߱1,ZJ4to@AbD>¢H k)ciA`GCHh\a+7{j!:bh]V"`0i+]h3i.c f "rkRB볩J_hUSxbLdVZ}xtZ<匒'o.>v\i[n:]>;dF歕:Vf[&S[&k7I֢>鞛|iI!:oQ[M;ONRm:KW" $GCo|կF(/&93ȧbJ)ϙWG.oO/K/kMAH;BZK6~8?-ˤ>+W_3b=|N%9oua07"Wǫ7WI=Q5CP`KʧF{ܧ6fd$'\8Cn b jm+7?!mtup׫6oW*9 M.G(f% EǛLWZ}' pdrX9&H<:Z/OL'`ʻLmrVRvXnweH7^|3 lDl4'F6d*#P;d込LPd@3@(@BCףN\2NSR"!GQCCΝ/+[8sE-Q7CST}^o|wuo^fk ) ;2V%% qi+`YTSU(]Kc sUE@y)ΔXhHDb(sdzH^D p+j0T;Q_O^W痢gtzս]Nα0-##=mָ?McCi]z6k.uﺄ<1l+`4Ct-9A KD8O:Ef@<~{~j/oF_++,3wCe3} $YSɓ_xSR)Ww{H=l]NrbZHԑSjr5Iuޒs78o{%Z0Tg!Qx녿g Hi%Y$-(Ё`2ƴDRcT$qpH!%RR)/y\&am-.IJdkC1qϡb*ȴC̵e9%9)PQBYc\>._NPǘ8fjԢI#(}ܽ]}:OQl°f{$7w1< 2^$3JCz? 4w䯲Z?FpVioS.Di %&7(%*Cr*~)$O[ڊ(@--5w1s_t>><FrZ "H i 9Ѭۉ4)eQ}W K/ \e<+bpO϶)gֆDZ:g9͸ |{g$Me5F/LJǖH*/?5t2|"碪PX;>N]5[z|h8[v'QWEɷd.a⦉ ˛JA\.GB:T?L`'_&)p((ߟQGO we hHO& ]>#Xm";Ɨ/CRQI!rHӆ'pon&%M_y}w]}HV$D W"Svp^^ ECum30[:x[]*ۥ V tKSS:qIj.p!s~kf3!Pa|5WEKIϢ'd?dD wB ޾I 4dEbF| _ѹ>& Ðcg@e%lt&yȆgMm.aNWg/ xO>Г.?iI9)7 ]Y[7XC=Z_KG]}Ao!sKovwȢstyfm)Gs'mBDr U8xZMǫlnN5K[VX6:jVM L5m-E%k,} a:xO;=A]zĝyX;)ֵ3 mʸt/s'WAƽCP &wq܊}t]O%LJG=M4a%741H$+tVkylY`k;9p \؏F!$[FU4Y֮X6w( 2{(CEg,KV:.ģvYzm t.` t1Km+e0CӁeZpbeb[~i,/?Ⱦ *B XkGrV ގalp HNZo(6ic_}yx/MAZG{FH@}ZAy{l΂AWa@Hfdh]߂^ء_QxT;?[Zbt77[R U*}:)JDA_IIK}pCbj?wwjDbR +/gb&0DF5 K8iF jrc<ūG|6|h_=(PemorT,ԎJdc40 ^q5k RTBe G޽ftYX~i"g/![3cwћ4#QYi)h?ǡrWCǾ@\$>_hF$(pTsg"Ձ۫uAFԶ? 3CQLH>kUӹMJ6aAwp o6PU9FܵT&Fӕd"$r?L{bwk6wHнn=x~\e ?̅B*gEz3ǘIM:¿Rl.?Y\' ѕn /yuNG4xa7W`򭪊W[Gw3h)(#QhJG>C! |@2ͮ:(`I"`vhI@o )H$kzSK@ RO/CM`cZ ?8A2,X$I!v"?KVsd!MVj=%q"px7 PQ"[97˽}o?7o0'w Ieǡk Uv#5]uk^wk!q3+:#n!}ң˓cngY{V6w{@du7h,637@qhvNV1gDTg>ӫ8\{*xwӵssu'Ihx5͜neosm`)csqAk T16BlG.mɈ #ta' 2lg\支u}{-vU65:GAiϟojy:i+q 8HR@.}L?JҾooX6I(*"mB7Ƿ_~ ]:wj&o p#hĮ`y7pd0+’p>9",a܌L{QYtiKr+툔w=7/Ia':d=? W~?Bziݏoٹq[sR7- 38 .#j5tI[#eNTnH3eε1ȟԫঐv\S!ywlHWj<~k9~9 |ʞ_v#j& ?!Cت\aѹy4uzZ\GP^N8EIGIp,! P yUbͽ+ώ&Yy>6m.ʴ*C]jt\>fra:=Ƈq5'GG/b>\Nӯި…-1EQ=e,TC?RB⪢`O_x[-?}JHv5U2ôq:i<^øxx_YSn]"&xϔyOwG4缄J(tbe WMd#MugpXoWcɃKšl|xG)^/RKoQ%D`< ɗ @tnjl*HqYr?[:t<~qoGKͳ%ջPH}l?BAWQ)hQ)H^Yj+M(>漿^ujG~ *:XZNNAݝ!y},\iQ2wZN7?pr҅ιH|d7RƊچ^Zw޾z8U9Hju;%Xg\4`$yEmjÀ# [I"Tiz@& {}M)˶ZTܙ:?KkSSj {#OKSҾ3D1ϑP=vk~OǬ`N>9ƻTds IFa.*_:1 h>jQ 3czi-A)~vQ#9y]䭳d/m1Ke{еrןW%uȳK#=c[;+37#ȖHcЉ!= >=|"3Kt\U^Ҍ'躁Cg .UKWr.~`';+X:+xVҺɐT9w9m,wBQ~C+0am!rWqߺ'z,x{>gnYH(S],YLѕSoU$-NRYP0"Ì]Q$/&R= VɪnN#2T\w<R`iKw:kcN%1" ȂAڒc=eXf$W ט`^4O0l)*nI  G~lWO8E5X%9f,11 $@*S%b;L ٷxj|T(8~[J[YwhVG1Z gv/|D='<$[h^.;/?āb~2ގ0cSfJHh L8@s0('||F謅GcF螞B0I(^r?~~o6 N k/.X/uDP2$8,e([ vq%RL;uu濄<@< 70ٴ]sLB;_UeOi%҇R~F!M=.Ҧ rVtAtd  ԡ|cOx?:WCz8-vvti.ڥOV$V#)gcMΙ \E[^zbCtx1BѱEh M+ H hQ-i0@c#"9{K:ӶBn,6161-Y+IPܚS&'IթYs~>J<#yk>~uqܲ<1jVUF,# rÌ9giw.|ٹq\I E53:J~ [ tc9DԔRa '\)sF3i@_|W!m0Gm |A% 1NabU> W!N蠙R躇N{&^㩗.o۪|1`Y I7ӗߢ4#s7"Z:30 Y']!]=ɮ1~u+`ig0%Q| ,ERP*УհW9Cz/pQ:x~mخܽp;]Y﷞s.AJTRql .MukWs<x˶`z-!v0` F"m^|,rItK;~6RוUICޗ]-.p<<Ϝ\G?~d'r?TxQ-k~2=iJ6L]zv:;4fd#JD_cEҴ}/)@ 8}A&*@z`4;0`'z$>@"<=}~uvG^Ⱥxt&l;Lwknp=6={57WrUkEzjk^Iߞ*{/]x1ŷ5I ˪MMn Qw&'|+v>qlˏң6ϤaP @!Q H2@B8m2$!hTY @//~ F;T-$!P&Cmz/{hÔ 0"a;=~Yw8?MLC{ypL W1߭>?(;eq0 &FGs=6N;#j!(! 1-!@n48 JWJSWt$!iR% )ҢM!6Q:SZh k;odpǦQS;.#-  Jc|6H ԚݭAy$tĭNe8%%})1YOLK|Vt(4Sk]@]9ߍiݟVl4z- {۾Raeep.M_.9 a5W$ 4>#R9) ‚ӇX:UO:U%L"Swm!qծ "gUpYCySI"j>̰e_Ly.V?'{rK0"}.0@j2۳*3b|/{#K@C72GUhW%}-DRj#:&ҙUҋാe_0)8|ss@t]Jm0MûIsbE*)M"j ѽ ֕[D~T슧u׫_g{˭eC/x3~ |f^;m+̀h}u-˽_Ƭ&kk"[D $iNrh=Y+eksDI9Yh7=_&hL"#(>%rVH8l}tϠĻQb3t/-TCЇpTxLy+?6{{s1[8;`C`KM~J-ܙVrzMQt$s?;kM7*s's+(Yftb*)Q1>1}Q <&PNhR|oJwFJ~MG]99TL2Z~qؼ_ %Ȅ}?"N&/@]{?H }X@+@ٖ;u6Q"oK(>m.s~ 7C6.FUhj h+e+^݁JF#I&z4D0pR@K{1!XfOU !L4y<Cy-t~6@j;5?+{?[.qp^>jkޗR~IZe*%3Mն|i]T4tŁ"c̈HMDEB&H*kbz]KE^^Ԙf_cx6csYR(Xol񩬷4KM@dbr""!Gs`j/%pO݇u , !2&5Mh:^rweYJ'L?TUmfXЄh5OuK,q;'M*`ecXؖVJ<;tQ+K6*IÛ؉b(<`~=2 3cV&<#M]Ob ,uT7M!E ܤvם2>Ps؟{?RWË (/ ] .DB zgEh7T4zjI5f USGWڴ?/ r#ܩa d2LԜ`+*ԼRiI.Z^vqJ$6ؕrD @!HG.u.?ӊ9?P~[sxܷP ܵEwt;NɇpT}L]/ ucy/u۹.\+|G ;\~yvZRuvꀈRa[ 9#ūO*¸|q$DUw-`E²{B1sI^=e5B22pL~#xSܚR7fA|l9na'oOgV8]*oe3jfu6]ݫgқOХ^ ̿%t(KsG'd (N`w/jBWS&N}G02}ۆ]-?IsbeՔsO;o`܉-#fPaڱ7Ш^0P_^4Ǒ^ORS0:z7tۅn\WfC?FqX#I(#ܸ++0[±PHpW@?dzh?d5&@Ni>V٭qv (&y:.uJkDBBʝǚ͒xsǿS_*p ycNHKAahm36_Lkn&|ew2wou} `sI@ px0:ߦ4:rfcC7_]VA.:8ʞ@OK#H]̠{nC) }!vxuTʘY9/OMȿ[ԧ5Ԧ..>6X+2|b ѣ3n=\+ϧ]Σ[zKg6%Q23H1׊͋b"ܧeV2P5&i@!xj>~kQ>?|Zfڂvp y/q.RFHӨG xs8?'5M際O6C[|&K_٧:C=^Z0%w).+7}#7koY/ΛF0e'sٳa1|PPY^=~u_xnu@K@M0?jTĐݧ"xIQf$XFA[-{Lqpmv\E*$Z-oй ln2n3>tPJA5dw=B̽s8=h2-evU9S!pIEM t< lw}X=A=ŕ eUA b=#)MZ&HUH=''gM`e4r o"z߰bg[؜Q_}\ +t^r=7܈r/}j7PzKFjKN~'$7"oz3?埘1u=6o+WRYkEsq㟰i\7ٴ<RO˩E%1[nV~`_q`@Áq("Պ@Z@Ha-u'k’ D}u1sreeK($(+"6\NY%DzkmZOOӦ3ӳ43074/9889bY ͘ކLmh\34]d+>k;E&R@SJڰ7)V:Nx˛: G9Ei$D  L~4Mܕ7z_b;Ou*7>J#OF /㿻v䲵C+bOԲְޥL s`~rgaˁ,߫Q~NkRHK.Q&T\w3dXtΑYʻ({ @\XñxL5XR͇߫tqRBx0$>(C M-'έȏ@3↠_M\hc&4~Q+^qame=t5C\flxA|Cm5dh (Ӻ|=į`%a`|^e_3# OyKwTv?UV|JR1nzL5owW>sY?o>и?Bߊ+\d{`L ]#6 mQ`v}_i ji*אBF1-^*P061 _XE2R{V($z:;l~NdNҡtLs5Ӿ\EW\&}:SoF]EJL s(_\^3JM*=iibdS bX$D..°/솹e& CCc;;{i\Zxo]0V_a[In5{M~.v?ߍ9{?߻l?{MgpOy~6,^gOa8'۳oޯO:fo};,e>Çt?<}?}ޏ{}ì[Fy{Izכ>3OXZ%^?}N5k> \H C|R[ ); <c1o&=2 YWg  bȚ1,5䧏?evE4,"9m=^mv,9r @HS=׃KZVxG=hI`s\<˗Gpw݆%5eve)c"ұj&bп/kjq߯& c@Dxst|`T=(av!%GY̓M;M+?^CG%_3{=Gx`p ģqބ>韷،4 ~ ,(~\~g݊.HB972(?=8$dE~xh8*}-~HOe?4ďSKy=g@Z˿orF6Hn槿bk[,[ {_kpkMwMj7 D[e0mtbV]f56}>! ߾Iy824=~rqEp3b %uV3+ls~Ɂ?x>DDx;TLrhƒHLaq~@LAK+` eY˖Ʋo:ߺC6\:H?OO囁Q=o9`z_K|Mx.l+a.侽X-{{yXHHޛ捅~0mከm#? ΰ:lS-]U+pD&kڌTؓϗyĈ-:C&|ک-ʵ˟}tw9ύl-ޘr{}n;Sb3{H=J'K JIi {?$~8RzGSԗ> 1Q~me6ݩ@e}UkʼĊi Zx M SÞ=d>]q?aZ~/A34fcN^hR.o2~3Է4J>Nen$$jY?FmwRrg_Kߺe,BYk8lUm_89x~&8(.YB0,߲¬<׵͙6oeϙY+6̻|O{sԭ-aZz+MsyJg"vr.+^^p<_9N3˜)r)od}^w'rn5YzBm x[ϋG"F5(-w}e UŜ6JSk^bJ^k SRyvxGMF Z]nfr~on$[nPn?Vҷ\xDtP쏬+Ni7k_ոmSN%zW_eТ6Šf>~+41I9^nGnT瓢G5zԏׅ۶&E66VNpc#Ft`ݏe=FݪQAѮ; c9Գu_;IşrQqySA+ezz%g)wq֐czR~3g~60]wFgMdوk7B=bO#vW]_zvN r8S ni;Q=?zM=BV/Amr9`t Eg;irٔi0>=C$]Z2 p7K(&C|dilT@WliU]&~ pySn*eҭ04Wi`bCBIo?cߡ@qM}D[z-~93)uϩT ̸@='}ҭ)&[-7Ҷ]1 Ziiu~UiZ:""\2pG!. %ʴ1d[*/GCS R(S*ZOWicS/(BּĪV(S;LXDmlg; Gعu*ﲶ{^l@jo|xTjͳ g)[j_A望CR/ C͋2&/s]k7*ea  QD?i$EP{/SOpaEpL(bAQWpQ(۬Þ3K8["S 4cr;{oGes`ʠ\eY-ZՍvDS! 4~U*=4Tf/:^S)eNhy+Tv:>Ɯe]rrc(.%л&(t\qzlA \ ai7"p륟bČ ]8ሶX߸rjnHgj፭ T鬪Awx*./E*-4,0 㼟mAX^+.heFuM}\5\P$х}qbW+Lr?@9jivl24rTa,HW\V6:$y5R KiI9L^ ?xp"3\=_ SiJHu>Ty w8-CmѠݝ-eաK!&ѳhdq͇@2Y W ?E+ag;4f}y~_zXZ!#gh Ϡxd\W2[XL6m$=5ig3p&vEnK{qoz϶?GgFr\"QU?w_Gv;_gXO/QU_ރ{6vZk^wWIy/8{AZJ5J8^n6/ߑ2C_G0 0$ݚwTPčuK~ܑy׵n|G"3{2! 4! qiGTrЖ(9` 7;ʬ|j遜2p4 z(%?I=6UddÑztfasf(fuvNN< Tųd׮1a4 Ml]F>#TO*X~a< P7jBR]u?v%/eGv){#{1 ^,˺ES y}4[GvJo,e-veR8 :_|\m'(95(Dnjv~!wX'k YQIK<3$?M(+$k1=e@lE۾󻶯v%UTUz[v Loo/woo懱;nuׯ nwn;y{@_7vYϱ{ otM{B:lًY͇yWǢ׫ҽ{{ڞ]ݻM{Ǹ{W0]ڎ]ht1*skV]4<44}:ݻl GJZ6U+ h ((*WӷN ( :0ۭtU(\0@h`y>)I B) Pl*GA>TJ$UD! U R* QB $ (:T@wJW^CB!>7@Hp}z)XӃ'7қy: Wʠ]jww6t\AswL=F<kQz-wHw I׺(Stqo&-۶s{G:(kð1֯p"]E>ٕ7@}Hӹ3>/8a)KT0EǤm0cj8U))W{JvwK[֕z鬒 @*z Wdk*K3\X{ &=ֲsrݍ ٹ{wxzo[Yzpksrg7luc םN A)*;`l+SUX7e^ ,У ht=o;ͭwswqĹdo1,lh@<>\1 ɶON0LlX{.=Ϸm[Ά2i *s `!bi4ɐd  hDЀ !iLFM0zi0 52`Dž'@Mɑh i2iMbj &6z5=M=1Td @@d#F&)d1 M&F<4 zeO5FޓTީ{FQ6OjIM=5OSy*{PIꤠ4&Sj MML)=MFR6ԏj4QSMJºC7s&@1]IB}&~'s;ߓ;USzn4?/Ē OύW❀.dVtg "MH9#lSA]ѧ">&E 7KZOV?>F=;?6#l_̉ܨkKCr()(~O YzUo&"#oDWI]F;T8H]InA MUfT~'J Ʈp8sK%Rp:/My eIT?)ͻNe%u$P@xG1j< >ipyF`ö2&}y)<~wCMP۾"`[h3rx9HnroYN\0t;?w z_qfdŅcX7]:h/>!;sG\+nnHRAl@aqhoU{㗇6kLI)tG񝾼KߠGFw"m]YOלiq{79V2;[v+x MOIS숛])B2:Pp\D9Wnt8w }bf rFc"Noh^]3i+T"&Sk"x28E+ &0/^_i͝3kk 6m]~^]Zdtƾ뙯oqXqdC oWT*x$9wgz^TJWRov|a'!x4/tܢc|%W07HS z?YD.D~"dF|:SړF~! ^;Wdg:|8+' 32 |TGWb1K8p1wsW# g &Yًxȸ$||,0$Is-|E;$"@rbVPcuf:(1CJ qГPgpnSabi!7TsDk΂Lz(dԀ@7yv|A- eoBj.'dcJYXlv<,Y+ $e m;σI Մēq*(қIzݩΰ]AK|k@$i \_7yÍaC\$=P=.*̈ MD{fJYz>vڿƇZ!ٯanե!@Wbc>~uGh xuOt3hh˜5YB2XXco̜͓W)4x:M*!t]dXتñjKg~h4{'w:|:ЫӞ $=1E 5Ⲽ /AgUo&đ_u-A2 }A0kV.b2Bfla^l2O[qPF/HEp|?Ѝ6_p!]Mkߛo_i "1ĨW2ꀲXrSYu ("y ($}gYaҶMl~Ž%=R}Ɵ-nG,ChLW5Sf)B:z JEyh 9ok48] ܔ069{t=ůzΧ`M6'NM:4!7lvu=̠Y &M/ -`%p k )*(`H=zZxr9incg{i !'vBDmju#x΁ Yw.+\x c_w{мQ,u^S%JlY]S *w*߆ϑE|s.Ď0{ѽdZ,nzы4Uc$7u2 q:4D{\RM!z&PJb7üIRWmSea\< GMny`W^xw\v}sXSI3鈴 TK8YC'44R$(lҲĆI_9g2)R7jRRE 9*E[ajY<6`g$UVcK 9:gIwTV1]5s(*EƽjMK;L1P[g$VX>ky.$+UcNK*FG?H@91륱 y-{: nF+ V ]Wo<v _L%n%{O^p(woyԀ$ 9FǸK! B*Vǭu_S! -[* u }$4xqLv͞vߙyϹ& Oc"j:.@E-|oKGc2]G -TX?D '"A%1`ŁuG$V Sh3Ip/gs=I9֞IG"FͿ] }2~s*{jY" Bt`v+:Ȃ6U`)AU.FO+(k#wȜD  F\P;2u}3o0} *N[$b*͓A;}q+>3|cudK㳪yǏUӅ]8Q yǝO73Tyx0|K@9cXamAqh B[hwkp8@:B CYH(BlgHtHvSUnI$l5HR!,_Qb"ro‡nMS3#}UV3p\!#y6̩. ~2;(my(!ۄ^4 bHAɈ: `@@w{sAճf 'X$L!}=7C31moP0nrk@w(<`o 'bI/@a;TYG{"w#*^fr"LsVF_0K \< [Ar6CKUHf"̆KY XYn7~+mLǟ.uX"t,ȶj6z^߀\?Ml Z J1c gߔ,#,HpTи>YALmG{QB;U%=7d3T T~GV{Eʼn ^@lCM gU(X-ÙT_w  l[3 J@wC~Ze\ $ctm,x?.C;۫r;˔D x=JUU\ܥC߁b2N4 K'd*IE3?se8A1b{DA8uN[|&YC1Ae@|SO Pkͬq=)PbI.n*ZYT/bGZAfd9A>ڑa&ʻ|Bޛ.'+B3IbWSqoH;!2)@M;GU鼮Wn,]c-K]%nTX"EGxA~8Wh?\'yI-.}l7Fܴ:x`;U,!@F Om16EJ5N b,C ުqgA^Q$jT@G$PvC=LپsyV;ΉdQANYc>,UXы5TpM*w[=RdԷ  Aɨy\M_po88u;o͜ő}L!eVG6#J{q7}s#{g7#ԤTĠWIBo"ϊɈr }t`.#A%2Ts)B}HEuKQT4E=Wb@4| 頑<}Gi.| "bVhKjeIn36"tbD,@ȗ_{y&Qx{ dPIS-_4_2?Oo3t{"B RR>M2ft[v IrC7LtuY:"F>ogc2ŦK<*(B/]ղOG$Y+x8G~Ayś,~;:C '"K @OKm\ ?.=&v}aS(C%x'(TP!EZ!y_CQR>?BD"=8'7{qdc֊2Lpp~|/YُOp;}BԬ]˩G _杽)닌 >M.DV GJ<C=ÒOrR[61CG9밌~'ӿ:nݡY(X1c3cȣʐJ6:aG9';>!­!Sez5ڥ?zQQv4Jo{\n^5 4]dF.)= H0ǖP [w;ԞNAH.R{@)T3121wɆS$'p)U2]I|bu Ԏ_gWVE\h8B9<4HH`P蔡;9-ex tKs/%˭¯HI963A"̙ ~)GAqXx =HC@czi\ AiІ>nը 5+X @51 iilr 5t3IC1֧4y).,k6l'i9mw@/i(c]Ii2)A4z%$XMجgULuK(ŋ|@DJ [1yScFxhH7n"ŨxjkJQC#Rp!K"]ɛ MY ,a2wYz3cw"&5+LQ+ 58txi!S}ySV[fֈ6PvE. l*Dޢi!%or q"6i1ذz8ITlloAhn[(iX;)+|.2.z^dc!yHLDk[ `;B"@< $z6t~;x΁zbAS.,CIG?M`eQX_*Ty^18SpNFc=M+w׳^llw}Xv{k"-27 CN&凞`:#.V劁ތncՙ[*gc(Ti6Fdev}1F9.zo.BJߟRnHxfj e:8Qfb%'iV]{b=&gLN 2d25UQURH"r_JYiiKOalMҗ\d9 j]5CpHGf6Đ`{czWVRx6n&uџ_aD+>8ʄ ($4YuqfD7n==s7;y VP1qǒ9H#R9esS}"cN5~@2SM&8@XVl^1ล(fG{ G #9B>Qn(&Ȏz]TIv#_sghYIje|BaտxQ21d 1FG:G!D@7:QZ0#pGLx./dz Yem m!X9"Gb`C3$A=0{n9pQ$1 ?bzϒDXk*;i>$RDfOn(i7Gk?f7v->lr$e9+OT0!Cs_\YLmή ,zt* jZQ: t27~uC-\D0*WBGXjid7ѢЏ+`er@09\O(MvՌx8\.xh2*lvWkP:[Msr &:d]L5oa x6d&] a\4|OcY7+ X[=Tؓ_IvՀMo?;'* -dTysߝ7|۞T ؀Ðd7 &-#jNvՓI. DdǰhN18cmG,%s¯:\8]<~Ӿ [aJ5&C} DWW#>,T_IeO SF,Yb/-M ǀ^YgRNZ's m%c" dj-L*S\NAW5Nsm;՜ugi,4D*q!7/烩BS`=hⴌ*(W$(y !;oxX|e|"4zQ ,v#i̠뚻? 8a/bQBӤ!waXc h1itPS#u0ģB"KV@duݪ|#[j/k6-˹-LMNqsO|1HG6vבB;,dYw|>>g\{O}ߎ tC&mLI̜ 3mt~g_QSW֝li؟/)k|ލ2jIS3d0" RvX7Kh jSIo>J7cz8kZKicS$Y6#0ƋOk+cǗ<8EʑKhFB# οRX'xCkaxp]۬knce λ3L@iVɯk xķ`Bl REAgx2]뗚/szKs0G{AH>|'iϯ첨Ux^`Z4M3@ lZ!EHѬ[&}s2n_i_7:wmj3^/ ˩3~K)2&NRxMYPU)P'#7 J4[̼0#" TA!m$ β i :'E52n!̃ϫc9/a쳊?%Xs=MbxpsWrsb Ι" (+DlPne揁WWtƬ1cXs$].TDnMy8D&|eOօ` 'u"R>&}ᲾzFJQI\"y67r4QĊH]>AYz95~dFq\n;ʺKU586>yOp}{G3F䜉Db DE^ BLa @sːgI*eF 1UQßD#Mmb(kRX%/2Xߝs?ґwx)E.'4ruUJr I 󭨘af c\V\V' $=kwu5SҞ VlcXbpB@rB!hQN[GfX:^A)z["A^CVTgzP@ؒ bd=1G+l -)5|="Lc_Ye K! nD$~վu`"`\U4Qu_RCŵneJmZ^*̈́-]nFPgg14oJ|y=I|s~rwn`Drc1ݬr&qQ}:=o{hj-GȔ;nDWei[%X#(f]WWi 9;?XbE5Bfiح Uf*9_ZʮҪHf4*fHI&?ncQ̞#H;ao'ŧ ` bѳ<¿Y|rá{f?.!ߢ6(I4+ &{Iv2yqII s @ņABkt'`% 7jo|6c;#{ ~Ioq* g_ۑϰ vm﹃_:2T:<4EԌdqVORQxR%`VJFp7r`oWm\8݇*/֢WF\5(BJ5Q8^tCj ;Uj:۩x&"0Z1Tu[rs8NH Q귀}=u]X{}1=mv./zg# dY qD2N!H )@=&tsO0I %AaF!8@ӼޫHe5e#{m4q]WPTj/ڨfHUI˛EY!$Ea^z)&#`%v\Rq 9<./[zh3Q!gХǝYk?ZhsVK]^>ռ%Ew416\篾'g]*dfSj!+o +3L҃}@gAj#1sϪOWZ.Bͷݷ&ml}~ 1c9dzY7XWCmUwO r}FHH z|,ӏ;. ]Ǔ{XS8"LQ+!tkSŕAޣzFۑmD+MZCKaƙɡ6ɇ9DoZn7#i9L%&zI&i|@/g>W_>@6c :%ȺצC<:غɁz\vt,%:( ـDDH$l9- "\L50%Z|&$U]Nx+=FE nQs5=ۈ.tgcٶN~@DD I[~.hA3ɩ fV +i\~L}{؎2tž6hyh2 =%e9Gwa,t HhwŹaq%+_ Wb⟻kډpYb$:~ֿol"ۗNh#=(N&s֔K`pǁBlj5`0$p@xD ,\FPn{llմY;Qi6n[!=~9e {ʚ>sKęC@u(vQ[a RzjIMWkVRʾ4 x-MԣBcKlb@ײ%Iyk>az3yF~oDw]U>6#j(@?(<^?txЄ|M+1Ȉ1oet&)Z#md*4ڦ|$(@F/-oFo]4nFC{r=ٹK9$AD)a>YMx,~˄{YtdqW'oNG’uz:ϠGg8Ih`mo''>7ί'-[DM`@Db DYV%lYPcaÅ{3ST5F-깽o] AHM0MQO j?;l ./@ByW/v#м )Od>)Z -)cc"u?hfYl !j[ر EqwMߎ?_~Z~+y5k+6^TXeGt;qcRm9r@چ&µgCĞ&:%) cn1~y9.fUxfCLw~V=vC \4M"O*{2KP֝r!H¢\1- iJ#F$u2q58yQkjISn6,)?-i$ﮞmz4";U#d A w5wdM}vAi⳨fw |TPrT*;eW3h`B0Y|˟n+5jd4|n"0CM=#fF  y6'?uW`doćoTlu諒)J``!E;QdFS΄Z@;kcVYn}Ⴝm>ېw{|߶p'ѩG[c%r)e6s{z /l_jKiIoKiB$DH]|2>C0G۫eUXgs7q{)|KeufSn !l KLɿj7yfSniyMe [י Y܀!&అm3e+7g/M@ ?HQIOyp>llLN ܞsĜ/- *Jl^Zn$vR7}ӣW1+u gvϧY<ʛM?jry(| z^9;gf;ҺJ`oi>gw[|lMw͎6M:f>7jj'F8yDN׶Vr#k6{'yxdg?qV*QxKg?"ypqB 1F7G+?/NPՌskS67@tSy*)<7H'a` 9\qHggfpܝ6m"c"".i fgRU'Ư{1|,U }PK{!Pɨ@MCp;YHtK!] 9[ͣ&=N ne;m]rp|4r$`j j+ 2 + LTC$i)jA]rl`,J4N"@@{A[ÞXv"i.fO7g.x>\]~w7d8~fOC( 0/ %占cKLJZ(GG3 ''5+{DX3yw {E.K*RΐHqݥʧy'G|zTcjQ!BC" kP> ~@RC.Ը%W2AR|d#vW9/a:%t Ci'/R&a:ߍO5܄/s>.wgFp62MJIT}VHyxug;XaE3r.{s gK1DVzz&sy-4 Yƚv|@ _&LZ=Ş{oCOkEnSy[r 江SkX.oW ydW+[Gw049';Q6mD:aJ:z k3ì3ݶ*䍠pD$Jm||Jl'H=B Ž\:P(XQxCQ۫>VئIjAGdPpJ 1 =~Hy>݅#SK-&0 !Q&?kVͿi?.mx^Dz$X J`>]46_$$!DR)_?K. 4-M|l9 և?@E.6橵Hi:7(bϠ9DU аV+Prq <?{LJ?CmS |B;u½y[|)ʹZ0hX9ejgMY39~bv~vY (PfUpc7nOLVrL f!xG$g 7~+[~'YywAxR@"OHM(Y\CMpcn!Gz˥K/5.\3`RH1w)S>zi훉z6%,n:*n]ڍ7C1&ȗoݮt~vAGũ01q߱nfo$@Tx@ 8T[2 zdH @"b: F2$gJZas]3d .z׊3aFey8N! Қ+1>k^|w.m6@"QwT$Hv@@>uo+6aB8 $WؗH#?|ɷ(0ViP nQ!Q(^,eP=*08NBJXE.,x%pc6Br;nW62dے`s$A5Gŝj=piI~ma7ÔrxV21\`-!@H"Nۏ6WfM/̫lRx܏}Z>HyHHq-"&C\ODSRcf9}F x|͌MpR}* '_ {#ؕwrL^$Aag7/K=p8y.QiȀp)NWY\Ts"71cexrHW, So%<%o/]0,F_S/$頫pEQ=im< 46FȈap@!l ׅ5 nMHPP0-5 ~;zi >{='e~2}%6w&-hy{,$[?G4$u(|vB]t! A OtPT}XI$EVctE8nD{Z_y˵xZN$ bTfy[fArTQ8(zNCw_x'[D=xnqw@ZB!9KN-b'0 stޤWp\mmX׫D Rq icm/w{ͷt@vY׻/|dΈxe5a&(![a|>j!Y6v{Xlg7y6?Loa#/VzIA_yة _/`XC%uh3ʍ%OE{3I0 n8x|,=NsI{%V7 @t^Q|4"׳5t zȐMɁ?aq(%k$ |9qqn*Q%x uB(›ӎdoeT^NSC@f kpOcv;.[9؜*,ϙ;dRAgq$Na ֡Ӗj4RedI|&9 FM: QF@>XX} hL*Cg]u;Ng&= w\IQmzkyL!5BIl-}M]1zu#Dmς&`b][N؞_Aߋ}>Qwy\֛/[b6 e2h25sɶK;!9+s)'X~2:vCӹ$E6+;nr1el$=N|2@@ZIdH>Qc540x}&n^ bè1D) {]sD2%յه`=n]6.$D_hcd)ôv&4A4I( o(iS_{X.|_}Q/qS;Hڕrk`|bjDf6Uy\FWw\o4v;q^7iE#Jwk9b_CKFMvAQ7y==9`v2N0'"!4l-AKҞx[mD|Y~Z٫\߇IB^G!VqW6;a䡽nC7sltE"G:I .aK;8>n$F)Fun/ ˦ ~\Ք*(L㶻L zG5}S "=CsgB9lOȖ1͉ ]B;R7\vQ @G 3$se S.Π*iܠ,r09Q0qzsWd-)EB4h8+(٪A^P G ؘ4݁7pq}iq̨ dp\Cݰ]s˝,oX_{qݯ/0#i%"1IB'`tQ?4FϽ҆tл GSV0z䛐Ja$xP|DX|dN 4JH$XBr;^3k?~NLwVF,xa(C1apf4 ~yܞ#:4VxI̫s/#2cYutQoʼngn#W.6VYgS˫q}7Ѧpn&d%$&6ZK _@_wLt|zcXW"VIwl=/h1@Skp)^ *vi"ZFϕ1p}lXMOsk˔Wʯ/JIFK.p,%*1lsjHfbE B>kg.Z98lu[՗] },QQHil aФ`+Uq9Iި~.ջѸxxvT(cvCC oǘxv$ʊ[vM &wi1S@HY$icLAŪ (wMt^u=iWt̕^\,;y "AY{لq xV?>eaf_JϋhT|h`'Vdoq̕mEh P差l-4[C;EʊO2,kݻx S 8(GHz} KȨܾHU ]Վ $&~*g˥%lT,[x> &@mnĝK Xbhr(,J!\;ƨ}bQOO%!:Gv^Miwh5k1ays-AGK()̅.tD!Qz,PMmۯagq,׬Q/Ľj(l3~R.0 DĄv}کёuA~zYE)兏}j4y49s$cmUseZ CcIA24Рme65 THE'{^"PYh ey"# I<|weC6}ӰOmp';?% +2!$vB3)]*b^i`;5c#4Ƅ=;i^ >ΏHMb<~?Ψ[x$:ۢ@9`/}@V5%=b@3 YH!,A圌G"Wn .,҈!(.Q՟O; $6𲒶ϯe$L2W?QODe A,p DUT,bFoRzl\[^CF',HFUMd4p@s^5rߥ01pjY.ILd6"݊n8N^&Kn|pGY4|7^7nӁh%IP:$z(@MBoj۱qE XŎ1ZV}TrbMj"HV\ClBUq(#g%n#z9ஆ "Bc-`J XkYvyq4z h3e|bس[WńyvWx YXXD~VH~h-SPHMM$ )z_ WA z+3 s4k( =_b..S1٨`9kbOY*EKDbh)EGM+M$k-h/uO6*e 0cV)hO] hHKulѓp<;)|&kڴ:SsS&-;LJw+Ҕv)-h+R$: pB`# Zp䦤(U.,̍7"#qVz0;7h~5nCpJbd1)@ r[^ XY\(f\|zԭ8rUKM-3ˑ:0QFcްoeyf04 ˧N Q( n8 y!8!l֣V(awN)An/LRRLnU%V," _ B<4"xX7j)bSiNbT14;1Zn{ا/2z(8YWiVP0DV9vw&ry1w('8L4F8Gci-8wVepD9E⺹EWk: gdm! @ 5_"Ɯ(0 y~rHtljaq \ Ϳ[9{hdةtj^"Vxl>q  L@\qItp׫w?7*KbpA->vvu}(qu47=?MA/Uey؞ߣ!KN` )ru 挵I^4R c}ֶ;SgBN.@#` N#XzVà؎ߑK^7GT%1\ꯥ?N|q_Y>eej^&1 b .Rͫӧ}# ls [_:fjXwo@ ]9%_[z5<0)aPfò {(|ɗD CMFVwqn9j-okݭ(5XB?xbLc/9=LW)*I1αȿsB`<c[q[hPOK_Zߩ3.Q`&1M{7Sul ď * &m  O&GK1BPdxӳ\X+īh{g 8yil>g8Wt_hn=3XߤN^=~uO!ffzT6#MCt G0Rќ\֑*g:*u=66W1vt^莉>Q/? ulOMq"& $;fL%1Dfp=Ο='b KuJ< /\a\dkU|]9[OيIb`pS5ܨ@IAE#do(}}MLTs1tZX3lRp*niU2<;roC'r8m = [k̄4Y{L(s 5wGy\il~oK׽'IlL77Ÿu|H3eNü E$DDH % AF!ӢFhDJ Nk8A)b[.].qo/xO ADDDFisZ` XUc;lūF13cE{zo'maԱ[ˁ1`TZe_rp|Xk t u|IZ,P?UѻP'kmk)8F>BtL:=vĖxBfH/ž1Ӥ-6 dkfRLB0"6Y ~~pBL}[~dy=2q\/sjMP::ңܘrrkăH4p.1KXecut*..^&+ )@@@@v buLU>p}P|ӻzNf}2sb/$֟2_2{pG>T!΢d \Z\Hs1*5a.HVmEa A؟:Y<'ËFYuϢb@ :?ŗnt4RO&XݯLKۈ~]3[W[_;YN 녭J^Hgm*2hߋ~n*65/"cء|5ޞ+s=Cbے7j9ޫQX*oimqWCq Oh -V1v7:cm?8xX<Ba(D bZg4/D(sI2>gE˄59S1B\H0xSoՑ(/\^oֹ/\|hQ$ A1PAl~f 8r6_Q1 P߰C5%D +#'ET5Tëc08K9I%;*iP7&#ˆ8K8HqQ ˪3CmiI֜ӵ%C/f2ɻSvO.xUڲá\RZlΝ'*5%A}X2-pgiЫUl=' SɘkBA֫ʵV]6Ȫ7o}<`-:ާ^~#Co{ }nԋ0hiW}v \oGԉ듒ƀ$OW <\՗A~t?[':t&*~d&!OQ e@ʖ<3C1d \j*4QDD7\)={L:;D6N& rs֍6DC x#$Jn`-vC^6e%'1X'E#7"e gdGesZY}E,@|q%Ls'حJ9S~^.ns7w ƣ#-*Z|ű--q$ ͫu(Sa)* |Ww|MySŐ8 J쏙pN-#4|F&7Ë98@TT3Tٴ>ex F'7 Iu&dMA/!ć],s_0oT2@)2S2 =%<ߌw#{M*!->p~ ~T E49.7#B=c:RamE-E'97isZ]ec8BP7{a^ hQKD/[gQn>KEj:b, Q!٧.s~~GvH}.{⣴e 4#p;ҁAg Q=/c2mbI+Lq<c_U(RZرF]el'0I = J1>M\ҕ@S>:lZPaAצaWshQV1Mؿ ^v \;uH_0Y͏XTK&)}9֛gQQ yyq9k᪼dqUc'B~'dU20n[7d`c9ێCbϠT& H7#\Y:nW @yl5'wl7E4/ 2[dp66Cl<_]BAùJ#Iۜİr$Vs5;#C=d}KyTu6ez˓5@$|ǑG肇Eea| g|yv3J5rr[1ؗ=&WxsY}ɫ[Y09wX+'Cƚ~u"/f `@O:B+ PDO 0RRg5Q:QL1ӫ0%B8ϐ'c׽V@f4(8B9ښ:PRp@⹈%'JU fh"sUr5"^lqDG@ 4@(5&#V!@n|ضjW1򻹝=,~ ul'p)١]#A[rRĐHR!m?65=@:.\5U@Kw$6u}u!P[n,5ג#Mk+] ԐOKfiZCc`^,%~?#nq|X )T PM4޳#"ʼn @gHeTwwnJ`$'N iT{ 3mx3y;ysxUg <)|>~& 62g(O,`:tf'h*9$8E( 5uz;Ex1ĵ-kF)$sUy=/5! B7= V&݌5ӷrͳ,PǑRa O1ctz$0>I~}fް;g IaSC+VsģaO):y@=xt)2/gǜz4L)Pp09 :1$ vuG 4 ]ŒOŝ""N>xD2 JT)hB#w08kŪsx|wH]6 Lص 8*]icN`@ho`V%(ŋw2b߂.HJ\xgym Jvp xtaqfMtTZ *>YiƯ+!da3W)8;"0kh? bdT;Z˜u/7!ʳLX t2?_` 3@=9D {flKwEg(dsm}]C:u ` .Fz!8y&8ۆǗ #Tlr8U0#Y >U^ tǛy p;DL'9y_M֨zidm6Q{*S!sO[$=2enN8[bE]Yħ2=;X]>2ݰ$]'Ŗrg;c6u[&Hu(FNX7+J)QI;5l346] ek,ocL"" .!uN`fgZva1< Kzg oڴ~b-;>HBll l :<ϥf8 K(\ Yc-${C"6nFm[ Ak9eIwg4z-X)Id*IvyNq/JDs`s&uxFCa{~HI=hN%XW,5>M-7BRg癀uj?SS[OzžE&bu7iF-bp/e} AET=r6w0waGbƯ|0>!Imľ*!%ܮuTţm~v~~.yA!@& 6(hЋ *SCR@5UI76Zye~Locr{()u0 rQ*Ir43>NU*vQ&Gʶ{Ͽ쏻Տ}l rUv1l?R^߹Ţa*å{17WȐּM9eQJ#_+^ŦړedfU$Wz,|l%" M̩Oz]D?(n9Zq]{1#xzC.."?n\k1UyZn*b^> j;gBk,E=NW2k/r!B?V~@ys;' n}Cw"GY un)c(:NjhO˙^ Я'臁 'ɯ~}L9j"GDXVzL"8$.i@` #L׶e7DCq̨NQυo"(w'f&h7rBJӾPjӛ\#p!(;#"7Sm2hp}O,ɯ[[UyRs¼Rٹnrr0l? q45 9CLβv)iC7ѷy|hQR'|pN7mY!-Nwgެ-<ZaqELcR Jyރmf@|u/kMn?c:)dXCֆug͟m%CrwB53}Vj0VWijC|,q^4" oqP {2}KlНWm4 3qVmHS (k7]էpp ,zQkĐ2BRYB ]Ci[+/ԗNV9M[!v1k_E+d;4%sD'kpr}d;' zVfb;REwI9"diޝ5J.eZ"N^} ung#\@) {Y o\'G†m&=,~g$$| 2 /jGnw氷#o`4VxV6eV҅j=|h 8ݭR}M0""&ѵ̮``828̎&.Xx'.Z9$K_r#\hb#(7f8&\{ HPx2$qH(`w:9ѿNd'o40U(A @g33&1 Xb2(ж́4ZN?7c/{) z4I%{6,z뇈F<˫B+BW'+FV<]^JH|M$ۿP8| Ŵx%])]>yjfecoHILqZe+~-ׂ = Ӎ*@\6 >k6,߁7ĎW,Of*ʚ"/E`2R庺:J fGZ g3I(HB:Oɑ_d4e؟mK"WQ|iܛW lrf|-7fަ! twH _Ko;f XG;!gSgjM Ukw8R{5;?Ѽ]om^$ >!u/Ms$`ʙZ v۴jLF/dFu1-2W(1Uy1Sֳd =X*wJScjާbKߤO1pdDزB!yrr2 NZ>C\|=1 DszW l#GHBVP[ q1ac_G41 <ވ11y{T6"/yH €+FAJmч()miޤbNOzvU.7O|V;AQ<^… _F͋IPE(bG0 mvgr}Nϟ׊FljrM(gT{:DHṶz^:>9=_ `mr8$TE_e6@fgIR9}]SX㍘QٿpU_EJR[?)srUE*p2s[vyJ^m*Jҥߤfjw@&~Bfi ZTcӼ/^ \ֈalk_7zg _ 9:ŵWQb7bˁ&h.eH(rK .5|XrW$髊Zj`&٠ϩZ0v)l3&٬pcL9>go޿O\=P2*g&{殯=Bf%$l8..@d6 >9`wSGʏ=W 6\6Ƃ G8}ԤL5N-L Ra A+qd'TR88ky(7'JrҩmXldY;Bɍkrw$mѝE3=R[P1_nn(0 /(!(BV8YjxgD9v.X~Z0?W.9;E;|7Q3 9|)6E{r0 |^껜 R?i\)+ʳN݃Xzgކ7X6tƕAWVX؀1ln=S N.=Hl+'7,"8*Lpݻ>\+1 XNFusP<`sbd#RroYj^OGn#vc?]96~}juJ/hu;7 ~~=#Gr̭9ەlZw8Qc2KL; ;d(rO\i+Ti`Ez}O^FqFd$}D޵e>TIgC={ $Ͷg[te!v.+Y,r7z)C݅e!LS|=f EAzWkSȽnN_H r0_p5#j ɴ&3:ov< ҧ,r䝧#c cyUnk) ι{h'$̈́ڳ|삁+hW`v /ՙ.^P5$ r[]+-zq.GyR!M[]dso=-]MRWԢ펆Rv7W*vF7[|Gb9:T3!H2]&p-Nȇ{{S}:2<<|̘Ʊp1Τi 5Bx|*" ?Vot(g|[Э܌~nyrKc4ENԵ,sp8:{&r4}%SFg@-V[/؅(HrmСTNcu &Jw HxLFW硧Qhy.$#CaPf:X15gmcLɨ9{W/uy[ePZGeY $?ųfz[hw"#gN+mHoxyğƦ xG{ZZ$$jHY`>b'AО$<߉Ϋۓ(>"$A4heT_1?{?:FRc$qNpQQ^'Kr9U^>z9R^ad̢ f֗5;r2`1 /aTҜt'cEJ^Up猆8A9ZbuD\4IKj;ѭ9$0ٖ}+l7E~e+`M/RY^鷗Zdd^(s@ :*f|%߹ +*y%boG+"濬-|"w^So/oHlr%R\RUt~O=wZ_Yi;i(z=cgrX->I^"*jSŸYw-g!!W[wkdzRC{\.dc@׆ׯҧ2;et fv}6Â%H4kUVw Vj? v, 1馳ܤ^"TCC#Ḃз 4U ].y?)^RGJl x8/r>ꘃ ktoo#*{!mIWNM(;+PqRT2.>WrPN@(ʿ<HEJ"PzbT\P6h(-GIyb5 jwN"p #&ȌHxgCkK;`s5, eͳs8Xd>ltsr'vbȁ[u"B?!K/i+^]qS*Rey O%Ùb>ʾ%Gs3wřREzy޾C!|эg;l>;5P"}12jKM'ƨ݋Io N2ya,ѼqJ#u)mE^ҠUf1NȈ}3y6SWġ>ЭL q/Ř#q4{V^YnUqU?tUjZ𛋟#ڷBOakȝghGlJP|NF+zTSPh+~޸ɝTK8,ۘ2QJߡ R1-{n+W0Nj=]햢p-ǨjKFgbDG#F=l) V:^]N3ݢ|Yw uԨbSXPq`ZJd N Dlqdgi)/X{PB6"6= T r IZ0zwXm$ҿ︽5 L.Ip[\gt[{h nTn۱+BRz @g50΂'YQMyҍ[՚]_%urV/|ߗ^Gx-T`7NcXq.ZfnC[rSÌ=r_ rqh\Sd9Z1(K7Jij'm(NK;Ηu֣-x,v}J o!YJr1ZDYj='Ʉg0@KqoaB{/*[[">xN-X^ы!EurM5gRcJt4yZ Q ]4rfc ~<{q4ChU6BV")_ѸR^j\~F@h ;`g5ʂ +(f/,y@+U8pK4w0IO/&".1GbNCOtP -qc\.lW&u=]K L.$c9] SЧZ,ԼMUD&x*Bs8BB,!g~oMM{$[٭MZE 8N ZvrXy9іɮĈscyM։ a5?2<1E\2k&(XeP12 _@ϮT51i0_u7-Nyt;ݟfY+2 )oZ)/\ZiGd䙡i"_Di.$z|]3?-+ h W(pKIAlxux 0yf8hXgwHKOG10Ugf!1 \^!.䄽Ɵ;R}o!Cd k'1ͣH"#5 ;V(AwdD2'sgmLN\Ğ9镥/rq#1 &#\LuKAzXGt$boO%5Ǡa8z&"*=c./sD!ީHf[?ţwGR]uT[78˨ &1&O)ϐcAq9n;O8M08<X gX8d{a6o?o/Cc)q7*HPz98T'{ѫ~`uKZ}Cs T[) ՟s]Ec,Cvٛtp2ϮYwZQWʝSAN9wrޡlɛ lI ھoʏ3'F;10ثF7io.]2B=uP28>㼐@Uq6DZxx9^7J!ɼHe^xY>Qf]Mep{Z d9 S$e(zYJJBx\b0RG K#^3$&F[+**v(I 5*4?q (p`"U!$*%{.Z9xƷY`u]4s\;sMiSnB/z8Gi.kSj,!I&AEhu@(E|,$>cmȉ!8m4lCm;ꮫf6O攋YOˁoQ诰wC&]zvZqm]3`',Kϯ`yaloϸq3 llMUim}.׌nM&GMgzʬC+UfѨm1mvSygTn @LGFǴ Re[U VUNG[v A8,#sE7 h{X1BE٩b2Nl]n5Kվ|=!9JteoIs]åvNBSUs-#~>e;K>v>=9{2PZ0e>8DVgcZ[wctl@QW)LOSF>t{7QkU0E}ň AT}6͋*~_<ɰmΌ:[]6G66ΜoA)Yv̔Cԉny&av;cm G[d%r겳7yCih%>HhmlhQXeЍMlGU'ȷISc5[Dëdu<"wFcdFG!5LmT½jZGեG{-<O@m1CY5;g h4;@ Vy4~tfzX夐T=vߋ_,R&eLw*p7@l3Ix͈l{ZReBŒ0&8fm@V%/+vP/B7À:gFs)&'w-Q0Y[׏*:9<+bOm(j=*6/P0q*|kj'dbaC?4+LP nn;yFZ@W (qgs?xtn+WuYmLq HͲEIVUHjdJZ OKWw6. 0oKbNbE<媺S<8RřY +78xR7Ժ4aqbow^|ڋ޴n5m/0!7%x=\N+1wEz=6Gq0tta k#2eRs9丟-"RzB+1,JّhW"8(*`d{]SS,_ψO2TE^uRHO})Gw0; EtMK1eռ\B>y;ܩ ;:<7(:P\75Y ۺ} iL}w}%,rءo! EP(xI5cF60 1$ k>ָ B &G49tf^8Mdn&Q(cϯp+&QY!I`,"zgVqQ) B{~:!#uѰ/ۘ1Ϻ eP.!A#$^DZU؇6;̼AjHBfƖ%:R6PLrZݎyxv$0]xPv]8b yow&Je'wQO)-r2-uц2&gidu7xWEVU\U}TikTw,BIJtBJTlIXq[k8xs5x;Zb)f̀٫LcJ,ka:ѷƍ'O7WT?zi@Y$0@R8=̞niGUo-|sWȣ̞T+5]F A [InnjZEu&x-4`#in%K曲5 +f59}i@zԷnp \K3&|('nF0IWmZ195gWj3Q>Z GJAVf؅pblxb*b35x "REuLRRDYRރTDC[şŠ4s.Yb\,eW%kB/ZMn n_jrn#H>0o`˭ RGǂ[ -ܟ.S]Q+p†Ȼo:u Î:L/oK](F㺆ni +5&mLrNnM-=>~Z24U={O8^dntxY'/+Yź=yed0g{mHG^hUMBWyГys6qtmbR?Ͱi ٯ1&4Fx9yYJK/1i9ʤ*5YJ^2,=\H)Dޚhmδ\EGXu7$Au'niغ~W)̇pQZڦhb$Kxn9"o!-"0!C] FSF_ux4{BI7+JULb|;>8 Ŀ/ƞܑG%=,!fD k<8CX<"W{n}B0DN=T`>4// XPeâfjȷ"Rxr5DjUFTٷ"B֩),k&LܘɪW|]h&4/bmg6tӆ Wkf:]*4<MƹOj,_|)& k6$1wkxS/N4 qT[lPYg`̠0C}1gCJ,Y)A!^nM (hLMWLIP"KG1YR`jc%v_{]޺Y5^Yyr;#ܙd}?!lo `!u-HG.HI6y2dFZrޙ k#h8L,sf@N;}¡#yb6 e_x)i $70)vܖ3/foi,/amKM{WHvMc XVebNl`15Yh- ] i`B4M;/'4v3FWf#WXo jk5Uحޖg0]T4u-u# ]ZFZb@b4# l`.٤X a1*4zf!4 4 8U3h ;] !}m 0Xz[|j?%RJBݴ .h$:(3, X!$4 r_a Gi HRѰIbHHbF&bĄ+YHzD4<^SqqzޏVn9Ws" % HAS! BEV9m#XizV.rB3,bd MيFɂBB;$F)Fbʙh$.b@P-oA泳`CkhKxòhHbV؀IyB J@, /1HAװ$C@$. $7 # ʹUصcV֯U[^kWB@C@shM#7=˿klEdb1nUf %pbmh5ߗu-??}U}[fummm[Vۦگm_k[]߬Umq[U-m~uk[nЪh% ;漏4(h=+K_ھ")[hCm Ǝq OYi飾XM+ , 韽ӚH[UkUWmtU|V&@#`ZH)iB<[[4%$4HBZ-]ꐪGxM$Sv'o6d0qJR<$yW2CFKKǖYyH@ X HM;.҆ }0B0~YAJmhFM;4YjЋM(bK΄pC5tVQVkBi"o_Q@pڛH7ޱ EAشپıʖzz`,V/Kʦ;:my7(m `5~&79m-^&MZp)@tOd!o"6Yd|}pOμͽTA|u_W-|F'x2 4UnH cXDozNތYDgm{;ߛiU33Wr`P sv󌶌ZbKѦkV plw\6QAй@q9ܪ~2hY$ dAi1Km,D6 lze{`&2R<5W:-n8Fv^G|Wwj !P0te}G)Ne z6.'Cռ;s [|0BwġYydJ@=puh愱W EgCZgO_0~,v o=*rZʊD+G#@@ͷ& "MtVHxS[oNcE0Jt i6hlCa&IcN{Tj߹hCrbhE V$gF$̞kFۿef):E _]n6 z&c/cD j L^RSٜk[<g$ iW@PT]솃*]A/"`0Ѝ%Id e K>P-u%Z@9XhBN X8a!J@@1:Mn7е "@ h5kmǔ$L[j(@!j$BF4,IeB^#@ ٌ^͠1y} v$&ag_~:JzHIhIӳ ^SHشIb{ `8v{ ^Pv`Д`KYCL($~ w:T0H~+3p:4ZeU`MfmE;.^߈аIn`YH7i$]+3?Ci4 6B@!m+GeB$XmH1$-ص-!E$ Ёm&  /C )`K`",%֩#Ħ=;+NMV@lO8Sak f4{B^$.@.Ux1nkW9no7~%1@^7#]fnl4!!A4 Iy$%sr, d`ۄ1(lH+H!%=|.V@$f f б!kmkΦQIDDcZ(l!$YMн&8=I,pɘ &c4h4- ]| #WBI*H_1_-c/`+_5kV\-ye6-!skxZ9վW96ں+Ѻsk yZB;xB5 L3h@ ACI!m7/Z=B\hcfLKw>VUvsFpbGl^B0B Z(2vhũ\b e - 8H<܀٥.cDME+ʊDحmo}65<BBiX^;Zfڷ ֯io59%0@cͻ lsAJH ICyDZظ t$Mh6L q81!f+_c67-}sXlcj8 }` %n&hYH5i \1/Bd\`/6kiR${Z[ZjZ2l$3 PU6#0b,[8 Ahd9l]k4]0g_`m݌jnێlfjRLb4lҒE'>w}!ҕ.l1} `5 z +4+1H1Yi!qZEf@0t`HK>4@i$X V?.kf9O_ݯ]@&fip!+Ūƒ2H I .[[9kz 6E$&j44&Z f h m!/Apf~Y xLsBId5bha1F-s!C" QiH0=ThimmF Z> btf-B]cа!joo]SL&(2 F@$2HRQ \^=:ގIh2QIQ%6QIj1Qw-sQ!"ccM*VKgcK4ȈLhoҾԸSve)i!lX`0r[s+nFgʣkԾ:}$ 0sx6B ZhōP\C W  egtZJ0,~4 /%@6Fd b X%K{^n5nthySiI"Q+@lIVpIIM&J!W`';M!`ŝC NA'g-䰼I"9.}-K=ϱH ޴lj=F1LOziDMiDlc*E$i2LQ)j(4TX(5&ܭx4hRB;# -H@عQ_P؛h8CZbPaʮ>\_7gOa% Ľu!CCp7M /BgZ GMzBVpbp.ӨCBvUͭ i]coz5Ot„v#t;?Tf 6$!kmEb &1}&ڡzŤd$ `I$1[j͵lkk浫{f5@ ~4.mqj֬!/[ko[UV[^n4hf$(\Bg'dbYM Ц];t ]h;ODش4$F1 !.Xi 4K9$  -{R5|޴)0I$ 4m$ Z uL4LŰ!666 o ׀C:Sګwjj~qj*$PĀAe$#D5WUZ۶mb֯;+.-m[WkU^fVm#^WymU! s h!ְK! ii!$m XĒx5--Z*&M#1MlۈZsBRuM $%~BHZH&Ą` ?Y_B=[4$ych(ZѢߦZk]5kjտVU4 ,I[fް`#"@-m$B @ 4[hXL4#bBD^j|ZkZWGJ$ ݉_4 V疵xkoUiDVۋU[UkjZono/W[mo-x,6ս6n-ymo54i f]!K%X _re|=%,1+mRj|&jYţұ $_^ KnĐm\hI ĕ5M_-I%KAw@R`f/Hrăر$lBH Mb!:V0 G1x-Ybg4 Lh4,VZIb@H|%صY!MC@<6 -[S #|ի`%$h4{֒*i!!dN 4MI+m#=b*1%p!/ٳ{uiJǍZFB@Xa4k@6hI"1>{x6@kklU[_r7Z h@,B1J<_0M &$-!i1k=TWfSA_mnGiVhB U WMZsSmk[5W`C\h- 0/6B -5 6/h\mhݷx ;}NX$'_?nи#g%&<4`1 @* Ұ=$#hf[H; j.4M5`0Cә呟V$^cFz-'5V[\ic0[Fc)3a u>/ŀw g!O>]w#hPSʽV^ｧ0_K x<8|߃`Udp_I7HڳN9n<, 'e5¿)9֢|?7^f&K7ݻ]wsjmW.<9rBB0PhXclD{Agk1_v<~<;ڎ{h*<9(+҆|dG{[,g]~?8M@[-[  QG_Ftyӂ`zhrݿ>my MAi3O춺mttHƁV*yX9G뱮{.aI@Րt]́3/EKIyp_:*+o+m7y:rǰ^=wsf d)HaAu#Af1&~dY {1иg$]sS@ZqPJguvKƃbضJ6i"lڍ*5YUeaRNT }8^Zn3AeeqʬEUqu.QPYIkB߭7} W8xO1ƈDC7Z=-Y1瀯8T͟#R{9Kе'4% [9P.B\J0 }x!__7 O*~Y;B5^hՍ{"4&P @X4@o/'ˬ{z>אw!)QMS pEm% T$)o/R!E?ȱr_O0Jk6C DqwI ٩@腸;G8Jd<^-`x?F3.4!Ǘڳ6ޗ@iN%^dȈr[/|j}Bp"7&(WR{MQ񼙶Mzk3ټm%(SΝPAQAnB|_c` ]k>#KPq?>)Ri+sБe<U=S9D Olq_՞$Ү`Bk1%\%MvXzy-y=,H{6eBǓ~ޯ{)[K{27yNBEq2ǰiIseǐ};!qf! U[Pذ@1GnuTM@g$5nVX e%LM$)+y) 'e.!ڨ&[Yp2p Ȼ|9QXbRbDŽ[ g| fA1[ h"8i f`iM&k;@f ^Ͼ߭tl>keɎcYh?A09Uj~2VXLkUͥѺP#԰sl]`nɰfdge2;DQaŠ "SEGAF_.hR+wJ+6|J?)?`.a Q7r|2_f!{/BYO$ ׳m\j57V䉹2~Y.~3 lu-B;@ 6(K-p=-g2T8Ӎ~Z[ȥLBBt\ȃ┴ AjH5H7@r!*BZD<;C7!=`T%;Tf)ۓbyJQX'~w}u JbVn:C3Yܻ\IiM怈;1(@D'gZƕFu[})l߃g hI6(y32Hr:>>F6{j +/a\,ȆsŏI~3~: w,s,U]pbnSO_c=`fg4p1pg ʆ5H!9QO!$P|iKO/fT"qư-kCo]4lBPLa)t1$Ae$@skmv3WQh2څ_š?ԔFI)!sFҺcwkO`ů `W8WhM2K(?Bo0H1l]7bUz佂O]|S$TArRЯg8 Q^R#wܺۚNQaEM{>_EXKV?R%mplK@#ʜ˝j1_IW^݇ev]((uG}dgAQ6-xδsKnB8>0TR@ 9gڧӘ\Lt RY/j:_,gseuMWcX !ř˔|W3g8m=*5 s|+?rmi감nePw9[eVSC!5L3|T>*pd$W.Ǽʈkrp4$UQ~ۢ:6: ȋ%8E911fw_I edYV jVw_O(6?r1)M5ũ\*4<#˒:rćp/CAo)ϖ>oF9 Ϲ\ͥThm4")Sٯ$_{d{Ia^spGf|S-l x 3Q$oҏ'꩚Vx,1p;gD"QU8g,Aϰ >h;Nwy iXF%5=gUKU+Fqb6!A2HYqc2_ 6C+Kf|QDjv@!qڮ'*nlM~IZ0(ĥT~{STe,VvyESVɺ-"ȕ`hf[㇎}y8KJ "I4h]6V=q"#Z٠Bג#+.-F RI.b}494iSǿcG^2Jɚ$ᨢ.Tk3jo-!YL'Kњ``1j', 0 i fuڟw-b6%yO҈b l(抵f78m?ߑSh%4cY#Vm?/ga[c$nyx_^ <;ԿpSoW'E sXrޕ)-KV2Rw﩮S9~M%`003?]1N4{3RRm? Tۡ}04#Ӄe/լ/uB Ԋs4B9l[ߥvm5bl?!#& L` )J!T m VbѤgZ[Z@/]7BVXY#v#`"@Y ?D@>#քTءD]ׁI$m֣Q3-5ng+[m_EFoR$k/pyjIiWi$hx !kflD449LT>jzv`/iAUs2;ت{V;֯:|1Hd{aE I a;Ef`b6$' Z٭W}6֪mmh^Ŋ'GO4+G`nؔe>LI_ hEf\V@hmXm *oXb0I ITkbڒWkܨ۩mѭĆb %& Β+/\B$|`~B}'>WjlMMMJ1quy?Оc|*Ƅby~Rӽ .{JZE /fg)n; {= {3U;wwg [83S~Hﭷ~=:$oJRc=d9h| *ɤiq]>:+?/,,Ոm\G. #y~V*eLl2{pЯ>\V,V['K}7CQ8E$=lCswrs">zǨkU|o⌇.%ض xt؅_o?c 4v,p ɹ/ݽW*Cc4)i̤1pglO8#03L&Ϻw?~$A LHZJLrg>@}Ŀ~^f[Uʼc0 BGW:jg`ԔsꚇVқ3@&ޤ 4IhdX vsz F&yg `kbGPl"(!StZslOHnUbE<UzWSmX*hЗkE2QB`xOD'=դ.E`8]Œm *EB3//Z.>B/h-)  , TʋRmSԛ{FPJAMMJTSJI1E  +-wmRЂ()j$*HIQBP#w5$UB`pK+dͬfbKwmݺS-ύvۡ!3!x=}?10$ kK\(hoDb4bTmmUWb^j=!" bAXR봆֪Uvu#ed3Z?wԯs gBAU0zV!!3 -Kc@% LA6]V`"! Ӳۥ5kzʮ6n6Ū!@f 3:V< bBDz! <z~ m|&ׅU Z-[VZH mv Ev.O$hp# EvA9ckl<./b߽-hſK%yPi5tj\-2MhгF#mOAvz$Zf"oGsj<)?@ӶXִ \dMozMr"/4P\Uz__ ʮmzR?Nlh%=hjB@k&$i7&mk-~ߊ *v 8$h\|Li$CE, ]M xo 9k R[ k!x؀Z~s|Ra5A: G+A(RA=QPϳmAr:묓Psg%f ,:iGF3i@i6AKĢ5 OSҘkQx:N\7Ues _R8=\|֟Ѻ9|gH1))dƨлP\vJrP$3*|U*A}=AvsBz|:nH^c i>;G$='yjasjn`5oN:}&MoGjUl]Ƀ>+4UkH^Ws3̄R%0vh`M,U 'QvrǾ2dibC5Ha# {Wǔ]ȳt\HCN"Qٓ4:{yF`8u5f뤻8^Z?N|Ֆ,/LX L/q%?kzox)|}m 5'C̢  ;XK,S(J[k @򨢾[O-5WȴR$cW2v; tUVigUS©4Sz%da ih˚bd$pv뻓=*f4 kX3/QnTv$?/q,hB DO$X{?K%3x>NWм#?@~kfd@kVџh2BXBW`DlA}2DzS|U kBZscθ*Xё'05|\7wB,hHYFpY55FEc A&ON r -l$uKFfxA6ǬOgͅ.-&'vh08vF1#opOF훉0mh3/^tQYKfĂ`! m C$\:Oo^\]3* `~ ~n}'M6$|L~Ba#9pF1`ei9${>E-YIZr_w;d _.)x?pr/x>ʶ랿/oűl6*~.qj?Rl@hgZ@ Mר}K 컆 v F/Ē& Y&؄/hͱ ĐH84hH_I<8R!smZ!N=meөNaL a5>ZB!]qz뚣8EC>zS]e*MZGuh%%UlU^Ū-[e[HWK^15g[^^k Q'Izw۪#KabYel-= *pM&/n+\Eh_J}iv꣹>tUS6ior&`H!(+N @!`WCTDFUΓM8I S72ѕ nɠQݨ: ! @v<9Z S(c5 X1 T!l\D j[Iy^I*nPH/Ƭ-HZX;gLl_D<//CнsH@M hp 鼘R`| sܸ d$$cRR?1$xM M]i{ Z@/J bi i GғG lHMy(bI~>~- h f>5,.0Ռ NPF́6jdI4wUw}0pKK @ijWltlHyu,$ĸ sQ\ӯc==m*?howǻejRao;Qiэ1O_|PA(TH5zk<]U:YzN$668h60&&Ős`bC @)H@.Ů( P/ /_R%`.\0Kb1đdD"/)`QAX0j+Pe1c?byub`A\a 0$I mᴑӴ~ B$4@2)1xϿ9vhוMMI<)3iv$R®}%Gńoaa43X1YI @s-Bm+|Vrw&8sp _2 N\̕-  0~Y'':%]nkC uc"9L6R Dql#?B2}A{1" f2[oavi9<ښ&RbT|?(JHxzqU y*ox֔_OG%TC^q䛥ۿ2֓ JK1%S[bR @NooE@09 AbF!Yv 10hKDM[ D~ &{UpVBWC~\{=ǧa8#04C=w$+M=C!А\阁/5KnX `w3zrhUVIai/b~!#t0~ow9p=$#G-4ذYbXmvUDͫ#.zZ#%o$t-IH^{+n5CG#FژMT}ri~%lnE!bD3σG8yU1<&asiHB^|9^O׺a!'Z|dB̂qt@q UK5,'3b;h!Hj +h 7G [>g1\"y挈t:Z40ef$z,h{>Q_Ъyfn^G)1'I:kUydO% ~;'!ZOv^Uŋe9\i))gƗ-Qs:Q nK1QPV܂e@ٍ$d!&KPTF^cEyv; hɥ`*i4lgVK.^n{.0aV gJ^hFt134d]Wb=PrDB?TKdGNRdfMQ̞EUIԿzZѥպOscNJBԋKRt?2l& ԮEq.ڥK+_DGKxY\*yҧbr/@@bRďDb;Ey3?}ӹrf:*l؂B:b{cUf[EuN5Li٘]i@QpnO_}hx:ᩐ ¯*Ha!Pk#Ӿ.KfJ />Ҙj#YH,8 9(Rfbc%G7^JmoEG7Qųie]T->i5;"&DèN's䷑IkY*3'oJ^'{sկbu9HW|AөI{Z}-i(HM`(οx[*^fQaϡ){.VfTw6,T/qZ ?yŇԲ""Y0 Srh ЍqĂwm/CA"'%Ch|ۧ 喙*Fdgr @f0i!P5rÇW"?JF+4vfk++~WaUs[Wv86 EUJ&\>~/< eS/Eq0'-2~ѦgJSa@@H$FF$wӦX4[NBJ4${yiw wj.CmoeE}<&Oi!}A &lHZFIfݩ4H JLêUo 0d*לH4p0kf,2)T !vcKum Im s %;I'vu .^_.I *Ɂ`)i 7MExx0-3_Pcz\`4[Uś 0#9Q:Mn!h/F!"ZB1$h ZHs JMV\NL XB 02W@C۱>[ygΝf& lv!6* HH* _ă5iV]Uc[mVrZ ּ-ktx^}R7pF OYOwL[Mwo TVQz.d&4 p@ r9o:30dP05r`3ϲ8*\KI=GObR4+Ou%؜в]+j/Aӳ9V$,֫6z}6N#Z@F|%Έ&Љ HjTmJ2Ea$ G\SbllCtH$Z!Hy$+%i@Q$ Tk^tN%|U؃Ա '0CcHMsBgkI{e(c)$C@-Qkƫ}6ߧj|ā$ZG/iO0$Mb{k[Mmђ,:q:J!gvBч_7q"U~SѳH~v-M}6~qs~#m}!/UzBf7r4 ~8t}WF`TD48]n¦^+ZI{0šb w=MRLB>p!)<B_8A[$鰄m3`vb~~R> OG%p 1?ԫ400kPaV0=J ~) U_אг ΃1;:9[hFv3ŷj__?T,]B00 `%HX^G" zyJD&8-аK_ri.vni[B@s۱CI -ii oQv s mf҄F׺:Ra!x]vepTBGe).>\tbV7r\ĵHQG"a9W1&~K J>x{EP>q\Fdmʩ"l9=GR,<_?Y2w5*׽,jn~-F+n0qlXO DQ>C[xlޘ;\Fv*kvSK԰5Vݙj/ &ǐCf.Q=m bUyn T@je- ^АF <84V0)+C ,꣦{]"٘x#4#& ]'z{T?ZNݻ1Ӝ "A<0kJy:;3{ETP튲]#MuZC o*Y W_1Tғa5IJ2v& }Lt bZ;*M5c `^nr j77gFu, _c )QcL̹K&זa>M6mOJ4kV@R9NPBXaY|y L28pEu*jZwԞ8] h ΖXYp[2\Jާ8A<z9M@瑠TF\׌'dg3 2rݬV/<.llJ%N-K|bt2Td _V ' R%U\ V0&旖񹩅'٩?k 7u+ š1%ņ+Y@ C,^j/F㾸$Ąxp9rH$ B&! =@eF@Q:@pvVPm vJ%V!qI82ΉcVP*(P Q5\=8& 3( 1VYqnJ+9zUjYQ?z2ɵAYSWɼ?0)T:rm"٫Q~ml₁9֐ppg%O qt_ A᫅`dU[|8iV&'y8 mn z@`7Lڑ~$eMs i{) 6C=XY2F7Y6dЪN1N ;}:OP3Q[XkhCą 3  O uчS+K yDY'J13vt4#J>-$Q5j+|DjU J)1G㹆.⣧\T✓rLrmHVCp?Y?Ry%Tƞ&44[6"y^!;%گr5wƊѯ•WD:Z iۧ+(b~ZɋXAv^iz58[bvT\ @;Lt]ײg~,%0zD'p 4^:YݒܹD:5 aj ҁgVIB& 3Ҳ?=E,Yuodʓ Գ6F/KM ,Ν֡m1i2#GNӆC˜JHHcP񕅜kƓ-)>$5;)hĜ/ze$uA|o3*c1y 3'A?w|HM=onB>`cþ]:I<-*R9p)"]y=>m}C-DwVP+:x?7z 'γ zf0~$C>:X8Soo/_ -TJIֲחG!d% s>|`geT-V"m/󠸿K>?0y")2c})ZNѣNxa]ƃO6QPLzIPFs5CEDZ`] |nҶߦg);Hj4H`#nv`ay'0LC GN :{wZ Oj16?m]14#4 $,IbӤ[F$,7-s *B7.CA2@`j-HH1${b9%0B1#Usc6 b_ϕ3m0p7~/X/ūQBm#j kœt{[8yE1vl(I6hI(rA lI@#u?o|p~T,hA4^ ?%m8 E!Js9l@0t8a%x^*i${u- ӻ]< lB1_ŀ0QcҒ[ypBet~uo VJ _K,sD@l[7nfeԔ9߳ ~j.b1 l~&ngW )?svWZpt}_ )hcޔSV漽~]$`wtDL@niuqiVR٤ 6HK1 m VT^w`i/bH6{ 8F N#Cg—:ʗYThl.I6㦸]Px\0>#ja _d'* Kr])bNJ6N29n]F~sʐ `jQ /^7Km-狏Ń=WUD1bWe$IKzq,?޾+ݑyp-%,]zcץ,$$ʁ"3TA:b]< =KbiRĀ`!%}HKp H3?_M]Fi@6#L^FC%oH{_=<܀Ź$y(}ݡad/֙<%||ҽ'/syoK+ʽw.Ќ^IUR |8h4dc :׽y?^+Uuz>_-IC>/U`H1n4C?AH>x0$>k4 ~eʹ%寧~CH3 /ď rX/ώsC4*\2J)SȨWd6vܔfyˑz훿,.e0ASzP`YN 7*/ KAxzBƃG(BD|nv! ӛON}L+2'Ԥb>/#74G/Ff[{^ڿ~HSlv2Ԯbh<5)rrYBLJDRϥ="G^j'ѽMF+0́4{),-%=^VRf- 5xxLuoazP[a`]X =K~SiU}Є;wXAxn ݞܐ7ޢoЪGV _㓂oZV N W-H@2 #m%wEb\BS#ouezm$u5=:€V:"A݆KPK]nW8w_H4UBRov^%$(kHt4PTi` &ƭh)Ym%9E׫wۙ zչ}0d $5*r搄 ֎N&ir>ifIM@uRlXA _W'T'#݉(n&؍9fEhEߵkd '#)Wx6#FwPI4Ra pdL!يA$VRG16>£r{a B}BT2ʰL1]P+xCpO`֔!e~ߍ=m-+kP[3')a1~\lNr*ь ʼUKgHyoNKmlT`dB2'M] pr8OӄhHEjW @ОQ N𖔆W(uL)GU:ۦzVq L$WWK&LЙ`ۿS)r׳nv dh-S<!6DO~64h0u!] X&p33Uc 6O6]a\lz'8zZ(F)B(HK@W\Z9VNZ[_fSޮ )&.Fkh+MJm,>w AjqM4z^k;uh;磁^<1!Nlo@RVN](HXUndܛiHmB-vanQ(k_3qjA?kPQ60aF'"Z{%6F)g?6Hg }5ViU%r[ t1Ze<^8eѣoNJJ6UfapC/uO[":i D*A) x-#Bpye˶\SN(,EIRFHNB)4 %q^q:k[JVmL?&׭l9 Ձk+2B h??]u4`F!8r9\]]qb<^؁iZq{6ur$ᶑZŇ5>+DīRp%/x$ol_Vz`ۢ:Y)(ZȅȏM;r ]=/bF27duNl]*M{s5Qz"mMv&V@ LȐH xȸO\\܀(Ip/uB #Rp-bM D=踨t0" I4 jTOmF$PE02LˣB N HqVlEa@zFw\4zUvt~TG^蛻zbA-9:.i:I֧T?awzK's'QGEAboʍ{]z9\BQRDdJ 0%xC ⨩!Iz,$]a,0a2]U4=^4ܿk?J'N3壕0Ր1T )X9 Y`xu-4m i={ԜK8y gM%[*qتu(v;f? ~t"l?@ƐM߿bHш)ѾI7.؁sE;Oޓf[A>!q;q%AT&D R,\}B \¡1BÚ~}9@k *iɀU6Slc>km.-Qw0Vlvm/-XF3iSy&gMܒ:FhX¦4A) {{3SB#vN= I#+ҥMH#"m\ H/^p8\"Nr#bk̮f=]0 b_>mNJѦcؚ͕K1+|}٫Gh;.?Gs򠷪 ƺ ief5x1G4w{}.7.Ay?i>x:wu&*K:(IYxwDa h*l⽗nSK'L_)%Q't ߋ Z>3Ooe7+" c"}QwpOkW f#mǥjB 0g].M"Yy.Va6$D_CԹ^NlzDiJVAūLaf@d?'-.$X@6]?\;^=hmr7}iSB|s?b;3د@<4xX~vo3jFc1d}1bVc^`TȽ:B^][Odx#s-ꯆ4HAؙҸy'NSMjjЊ`$
qJM@YpAJT)W.!f MVnq2 I1d{d|$aE(&Ӈ˩>S $wd(bqPhphQQtY,޺\a$ 68: vС&MCӧ]3%75`Xׁn:sr<2:^^2k%,m]Lvl%H]Rg4|ނ]9V1j+}2ō{m5q͖m&? F 'S槙U麄,Trp]j:|=E7wvc9lNzzU [W"4H-O"ݷ{v  ~zə~V1LD75#HR?[IoUM=j+&>ʐ) $h/Jk˚DžC>kOΪֱ(S,-c5qt^'R8Cslp^W0 :%˔ JefvqZ?-Gԙ鴳TT ձf9r06_'+g=.yFY "$2] !e=؋tm0Qn3ybQ A (aHЀRNXv!5nN4s2Y9n^ w#F_4`ҩ1b@#,dmm C#3x'j 6+l9~E%6ub% g+g`wsr$kAW,E!&H=hty._Zm4Qxm! DhN[wcd1AVh F/"\jcVU+og..]_U;w i/xot_FIi OQaBa6B+y)F/w=vQ1mU/3U104OՎ^.NoYU܅YqVVBTc)$RfBsbJ@m\ lj+! "UCOi- St9h,wڋ Cqq<`VSΩhq/Yگg7)U)IT!F0BY$m@>ɉG?61}Xdw=羛K`c:#HPcV4- &A|[Ə IPėm_i{oڼ{/hmlze^v]3_Ō0Y\7 "l*F xqGn^lW W&^eIAY iiSHpɎl& @`iŦ}&v0A*pM:%ZFN"eTFDy(Oa4~/hX w:v*{ͭ*4pb Tܾwl^\6SҺ9χ)鷂tO~HFK? ؀~VZ4]14ӑƾ/>>V9h0śE_?Zř> &N;ܩ7mSiu ˋ-sk(Ҡt,61i%mDT[-p~5ݤU3-VG3H@clc`vؿCgX.O^0eq5#jQ4MTMmm ZB6A{K-KB vkMӬ3m&d Đ4 D>,Ԍ_$ˉNIzϫ ,By3b K, oj {|LfBu wG; Tܫ`Q+?*QRpӑΧCg:ܖ0]:8"H4uI3ҦKXq?#ʏѴzNǍ|mW"iP±}xfRF@o/|\̌y xچ%,XtkI=H|a0V3AiS+Y#n;mgSz(*ܽ޶Ć ƅh"jI Wo?èFl<~61!z68Az<5~FߦM$BQjuU1Q/&/gĚ-uaqd1q S)w n*mdv-ec^%nFO=~qU1b*hոD 5 #HB=k0d,h+nI"зĶر5'XXti=Ղb?Y>/붞]=b;6ЋlHkA !~6cgG[2{3(4yץ1Gƭs sd3@/+%\jw#6{PN,,0A׫wtsQ&𿵪xw_~nV%m$ l,H>4}HҐ~Arg]ibadϖo5+K4V %g޻]B}Mͤ^qz}Hа4Лg{nohAU񃅘5aM Dr&K"yHZ=rZ"ν#N Atͣ Ieaܛ!.$h 5|D !2ܣ)M0nd5"oZwV"' oYqpq2(R"5VDLS$|qaih  'R >!Q)5Zp|Nn3jIyS+I~7 Tg??6u{< fWA]<8.-2n 9eƁf†VJu7"-DԣeIiW=87H+c݇op#Q`OZ:&RlS DNT f`$IǟH ,(t6?OC6'E2"vU+pxgV.Kk;i+/'gD[c H+:Y26<ͬ d}wgr/cs͠>S~Zkgojq!N6N%] R5hԳL-knX0}ߞ܇ARPU`qKzn!(N<1O8j7KggK1Gٞji6QFRu׋WO>{Nhpp }7pónRcm"$xQA~Tt6a =c/iNGk 6-*806|64zmV=<Ҷ6ܹNbm8n=ОE6"UɖD [ǩf'Ogb޾.i`B: spn#lw,$LOx eJ9= d3)J 8uZp x?iwAZh%4gބvy1~{Xh[4>.li C6<ճ0]B0"P/!7(Urk٧}HΒ0  ? pCme,M[ܑ }z !$ѫV*fm QHڋMޯ"Lbj 0@]ƻ@!0)6:) IQUyaz8?xo"Z$@6$r m?G7J=JT< PhM@1 1*6C07]C@M ~#[@: II0μlں[6",FYU5mjVQ݃ @֑p#{:ADV@vWq )Go|_p>}+])qlQBDc}YAo)Rts4DC.uǡ߶Ba+x)җpʗo`aUso#zT֭u{-BJ݇dZ:{Λ /`6}dpYy( E$ D  H}d1 \ @/GH]AX< %jW~ܖKmlDV kEp6*k'E`'t +ЎKK_n' xz ̨!!80ktH/wlZ_J! :W!{ \so\ƚ`thVZGhm)'bn,$$,^QSt&tphK<ҡe6G+i1ȊX ,k'^4-$Z(i }65L>sIjˀ/ѝ·yV 'Z-m|6O^PZ E5 -4!6I]A<90bPuRGhuh=\ ,+`.̄[7WLeuSze$gNġJ }IH.D:*~::"+"[ j>E_kcP4> ʙʻ%5pCBl4M!a.52C@[41,WkF4yOQ_;iūldS|QxUf *H'%V:K,m}WTgtBf5-+Y | PC_Q@j,oVJUPMEo5T0֭W x M|o5ij741|Jv'`!s*8OVaW P Qٛ4ﬦkUl6Kn0 CKZ/*ɨLESBRb֥h: y^~jg5w-u틺O̓{X;!n~R[).T{J  a|Qbd_7:41$LP?Y]4"r2 7 ;PrCmӵEE%'̹gZ/ 5t}}g :jf%/>?vKvL@ D$M!IRf 9r e% D(p0A#X^cX_^+[6X ȸeQUTbJO=ZUj34c }WLɨΎ،'hrX`p[/AcMd?ǟ8Vڧƶ]qFѤjʤW1q믟;Dd$QvɨVV(MۯOiHSwg;xÙKrr.G%GHʈ-p$!$ m12QxM ʾYƩwHPj?!C7^( /Hei"yk_*ۄ(@} (m-Q2;uX’"H(v( .;)8NbuIb<@4iwd<#V׋|qic[HDmj~5'̍so1*R²-K<ʉ2-\`U቉\E,}:z]kPTJM*vcch9,t\@ۼKlPbߨqju1ot\ @8WMVٰᒅ#[2xV4-cކl[R3NUH6PwMlQ!NI;"I3h>/q`b}*SFsƴq(l}n Ң>ܸ٘q|*0?!lO%oID#'YJ`x*CIVIRy+NZ R ڂ͏SC{W,q]&];&Q2Z.T,GU+FEzȨWM95$m4,לPPU)zXY3Ë󒪠"ztԹMҬYxb(&;sG¤"oBW:[>ѝTm'vJSkC\²O!^{o.0(#$o4cm[A&G ,0!޾f@[64P*ξ%H˳ (mZ)-)蕨>KؓˍR= UVlɕ-"2la8,Ոhu@Ի6" Ee2SMG~uꭚ431>a([}L\wi-4@ l|Rr(1FΖ˒jJ݂Hnh_;ڒ&>йNm_ţy;>1QŢ8 ?TZ'-D؃u QMT7}N3*_?'e(**`( iQgΗ04\ciw GykmĚ'oGaUKl/y+ P2n|TBGzcTwa@U{ |I]aħߝ~p_=z'#!'0xeX|XhF}+KLмֺxZo?gQuƒ8RWO7` 4/?_=+xH v\@ĘdO"Cl7p#Qf 9lY2m%MTl h>V(߀@%%xT7GG?}]?M@ @NCǩClKi(=dyYyQ(Ǣҵ!G-8{=SDHqJjtFU#_kꡯ: k|/gϪ@G4/f0(7SB8o)4YrWc7ϖd.L;=eѻ=s!\4$47HvX(h]AǴ G&u*)ܦtȥG#ge}@ Uez>ڵOs0-MAIqɅMj8Z Ed4r U¼,W" z˼ @sz4 9$ɸq/N}¦ Ss ǖp*Ge}##ђ1 tx$6`(ww*0J=hlXtUچ#BKm!"!/{RψZP% o*w X.° 9SsfzEo~X:#Vts_ItPtn%axPMC.B v$ $Bv 522pvPʤɐÅUg-;u#wiCP28fl9 `LSKܵ]͋b{-OSյ<0+9l HShSia4JX`3Wƶp: t}wC&Y[hg+TDč)ڈx0j@2MR*n0F4*nEebURrۧ,WNX=b \U΂^S<~~戶 e>'֚߱prśKMb!Ga- ^2E<ɗos_0:K0\t:զ,O3X$o:r.::Bnb.OZnY5?_ذ^v~xS$nA@ѡ}V@zfך?ћyp&p?0壼Bօ`XЩk@"Tg;4gL%A`٨&! P2M}&sWuC{1)F]7NqrEWIyC\sh Mr1rg <==Q SP#h }*\–7#_c6qjO_k0_O c+8p0RB'ea{=tNдlۯ _plt _wæK~+LmYNeЖ;1Ze Z0fϱGtMQѓ`s| m5-=dFŽVP2㟖ɮAi$YjW]b/M@N3E aYNgKƪ{k]{\Kxz$rY*6)5TAD4[6.5g;|8!bJ,́, &9xWڻWwHxaG²FՄA"9Nzi(&j'|&dp6DBPA Ws'c*t1,Ïoɏul{v U>K ~bl3)^=VnJ8ΔKv']aV/*4̤\bla47A5~h3f?_x}&41yev -gs(~S~՗IKCC(M#87$H{T][.0 >p..p OjC[{f are{S?#NOxm-_Zh.ED *(Q!^j; ^h "5_ C+-Q}#H1O%ڼXՍ;Yѕt46ʃXk"[xV<[>y|Dp3ӤWm37 SM⠷C\P%E]%4aƴskަn|I*NALiG #]e/r3A֘~hMQT=SFAH6.qSKbe\({)$$ʢsEB$-T4")6!J: t9+{< `FNmyڐvR! dr5W'qN (a8, h a "Sp] CғJK6٥(SsJ WULa}1ܨ3싸UVI _t1؇##-" UH<)❚BʢAxe%WVvJҌƾVPq̦Rs4H.O.}ކFuFf!N$$G=UIl1=-Ywcە<= -:eloPCk'-kIQ;hm煵 &F4Z{ЄD 2bu@&.PVhWCICIJPXcah>ጇ@~vNtpܨ (? o8BabC 蓙sE:wMr,8cPܯbSu6dTU$V$ @2DNKH҂&tI֎SM@6=7*Zo% ܃oJ:`z|{χwBhGriY7Ut%yU攨 S)<3F3:Yх$G|(2 5D!XT|fPnd3 zC%VNK r;?FZ (L\n/DE+Ać!yT[;̠SD seCij6v}̀F~oZ,GԔ*Ig^%M_3JsZe)w$pillr^dЭ2 ɦ)Դe(Ϲ$nQ^R`z;Nc EL_tfQk%S/ydl>~[ p Ebf6ćWWaېK/j 7I`Yї g$Q;z9~$ ]3/VLWN؄[(SC \d3^Gq,ib]Ud6ān"+4&`VdQ&% J#*Ë sF}FW2,%)23ґTtDBAnk`_0u<ܕخK~} nZMIU-D<80bbLktgIXAIłc8J|hQf'C\|1y}5nICIaa`LFs`~|шZpԍk  HXP:c^2r(A u hˁ'촢ZYՔAЌҐ$Mn&,3keR- UjI¤]dPxY4_;\tsyU&rfRę<VP,]\y!>xH}͙g\AH O˗3IKA7ήjRJvkn~y*ϲmuʪMXjk9V~ /QY֝R^t7=*51XH$@ ݖp :Ivt0YyK"f)k2+Mޞ!xI$'9 D1TlNQDt&ӥL&TEEKmd~):bmgkaB ;F?!*`sodR{L޷ !.`x H" N]AˆT}m%5=3FMw~bi C46+6`LHZЃ{(1z6Mb=WGyR<&# #Zv%eGWiYi$(Z+{VɟDs,m<L53\ˆm_lX (_}Ͻ/ck&g޽< ;}4'A)0O0{`Dr5o_na&sN$I/Y !0mikBΊGק+%!vv:JHJaܰj"Z' 0DkAf-dc>6=sjuhv47@/@ZKLAF3o ^nr1$u^ΔS5o3Xz̯msBM5(4^ޤ{#vYkb$ra@`{BM(2"i#1Wq'?!ы/\uΑjvUB0X7N\B ř<ϫwF /c*wV(-G7-7^ʗA7\rn:b#0k2^\ʘۍ5aT?ո|ys9woҰX7eeB1BHh&OUE޼tpq8l|O\$~;:,G#.'=Ii_}QݾM{7䝬..pP^dyK8mtug Uoe_&i`/?O?FaL8ԀFI-i?r\Si8ה ִ!Yqm9#xԦ[R4iJA5CA e8Zw$ f7̤f3uL$Xp5 %*Rh0fJV(&zI(C C( ߐ˄Xz!&٘T8NL|Ta@! wu`u%!!&`[B$wōRs#29FÍ͓l -|I+sJa2Rkqz9^ˤ=OA"08z~j/\`,çNPaf{$T.o˒]ߞ,d(6i$CX5  +p*ݫbşv$Jdl17&|l/S͚jn ,ȶ)PCK1,#yLrP])#8|]\Un1 yI &,Xvk8<}\8!]^8h$73)eGo0~RX٧(/Bhɧ"ƹ9Bױ5\L-LbBx3nv .}DFX@`>(Z'dB6RH s)r|q-z1CОp'Ad'kH &y|JXl;!n$kV>iFMDb pXaW(k4+G`IzH;f7^uZ/:oίhUۈݍ`I ;PۢTH2Deݜ˰gFp&q"F}i5+d[Ճ- 9mǜ~w8Z]|R M{7,q6\"2&yj%s~>-36 pDp7olZTn>h1T CI x^7 EIrJ  ,>{׿599(;ne^iPx.FE9 AFSW^H?գ$#4zO} C8wGPg˟7qѯFFfBuk|uX@p aAPB8I1D`M&x ȼA^=w]}?ynO!0^`b! crM-/78{󺤾3Χ{(0)R5MwQRqe :ob{*Bճ+vW(krwўx:,S ,N>4b0~wj} McC  osTۆ&o~6)w K3.e" ?ҦzfFT I/@M#,,}B.6ijzgz'-xbb&H:(Pp #Ji\az¬t"ϒTy29/5 AqVlX"ki|jJ, Eq6PV?yIX0(h9rr{N`DY#3@cwy \P YOÇ?% )T]bs #,0FL6^Z1r{g֧h82j4DZi dhz/hIPND`$^xUP׫ VaM} FB8FUF1\Ok[=׬.s Q<>`Pʊ`ڨexK֏kz/$\֤*F>0H%$R>>Ā['f,&_KK?촞jMQ07@0GLޢթk{JZ!ut&fb`{^noU:>h%G%Bz?8kV{v#x50GTD lwC$h ydZZ{]tnl*kx甫Z_}RNb;:©3 rަLq-&dPfJ,hs"^ǭYM3T*R5aT4;ޒ$\F&0nlF]*QJO>*lj@Y "ĂЈ( o{gMG& p?đL_tjiA"\s3VahM>~ҧA`A1U'2]ɆaϚnݙmvSfB,i1 I3 8ݥе}s;ǘOgi.!aoܡ/~8ɼ0EP6.]k6cɧ.LX2(}omI~3eiePaN_&nyj7;-߻pM˶ 5% %!ԛVCyP(dm8';o{p]_nk3.k$?grvd|,%, ¡f2զ2= @keOi9j]h=i:WrVH |Bݵ87'@(^5Oĭoos=̾p5 zw]7y|u aId$mj!_> ٽ;m8:XFЏ3Rqp 2N&)Z}_\FN_N—uub'fA o֘5wɜU 6ؔ?miPӉkk[ľe H~qzfQ.N?Z=L]u#S ϖĨB4{p-hϧ.a/i'bcq0G4J-Oԏ1 Kϱj9 F:0sk5r8.(3Iڡ??n,m mx(pg~eؖز" D`cF9TvZۼW*X䐜󒭆%˕N_N+gS;:Ɇ}w~`1 j#_ƝJ7R┻dy)!hwѨXɋ 0l^ah\[@`u?pa۞VeTG59ϗy8II|dlMZzZڒ6UDm0M {?Y=.i6R.x Yߠ$В24v7IO0OS]eP&~_k`?Ǿ +_zգe .T}I> ijN?j3y&WzSNĕ W5WEyqR 8'Bа`)cK'8qt0B4{jn)$a,_u#&002 ?5kbc2Y\#K>HHؑw~;?YCe(lNuhp׀٧۔Gpcb> l&U;7놠D {jx Y=ˀ`T28"E̝#7fuz }ڴovu=zg-Wۨ=aۅo%HtFwKEAI*K'(Rcc1 Pl9uxK~ ݰGN'8<¬`t;6; {UL#Ku2u-Jn-02>g 81azX?M6J}8ڜ~HA?ȧP_KC1h~|T=_mGTJTY͵_cCc<3kÈl&[ G#uNjZ,9 )12dkB7M hKC7-sZ"΀5a LzUDiڅs-;̮S2~AHeQq"RgG2M+\CX<.W7Mhy0iov3k(-fIXbLR"P80~M(D@9@~OLInsz&2dmeKoeGҿfkoH+s^#G[>;=y|v;H,@? ؕyO?=|Ǐ;ĸ^YL{]r>8,|?r00,_/bkjueQt15EIɏ=?t5G?[s7[uq_RS [3U*ߧqbTvZQ!B a]_eTHb300_#'S۷I<B '*3eokҰp8syؾ'K1ܹ>cGq77GK)l^{lmA0-4f~qE~^3{#:H"q`ʐe}K ~y̨q_0r=Y}|uƳ|y?FW#OB%Mx__wW`El48qu?'Z'…?rYYlBtTl_/B1_܀_a}US_߳ r n;IOZnǯk> S9N΋}9Ք*[)_gwwJ}J}5;VFpqywK53P/+&\_󾟃>;8`= ccߍ)M%3A9ӿ,=NI:"`~UeVc#Sza^I=ꝋ9 ؍X H4re l6ߛK~mj`b~'TOuMڽ蠾joǡ&˻q_}Y0#æleK%V$s]<2rzuXC!#=GD& {w}-{=zD2&àʠ?压 ~^fm{tN8$;ʩr峦2a1 g |pؓJ KrPzD0po;vߏ:}i{0F?*22Xl^c_c"։mk~G (TDAA #sS=xxco2cYudDm.%\ @y4/^B* +%6 sT1E}:B} :۫a0s;~ -f_iQ]t^nfz7MȮ -LezBПSj?3'͇9Zܒə0R*~W+H 21/?d@ ځUzsJ1?FRPu9wY~-j2~q ௖&>l{m4` W:i8'u|Ə-?¹ũ͟$S~ЉΦSYEiaA:}SVx;&)5T?TgivUVotLtߣʯ4w#4˖l V*sO 9`NCQS 4w ~6߯ǡ>LZիln9Z55goAwT˩gt#1nTBFG jtSW[N wՒy_*QzF"l B<޳ /3ͮ.W0ؚyɐo6vshݻ\"ʮe 4 S7c͉E>c%c4B.IYL{C# K0y֧wŀ^ MyhC ZTS4`4F2QD4L!?MuDvxȅMo cm/SSMA:H?Q3So-Y~Rj#==ǟLUU؀|̤DMO=[ ;ţj"zT.CsVk D8h>ɽӖ{4yH?gBO tdgKp;0V)YY&z}[Pd1{E+0$BVrkeqT9avQp왋@T˒mJ()U s#/DZ'\w$I}n`{F 7ucCYJdߗv6E2ـerf/PsqU~oÌZqaonLfw-6.hPBU _Yя-7k]AZN$TJ~̔\|ZdPgsOUg?]vkK_>iF3괾+8zTvat&,3)8iѤ15-CY=k}Fm;.-1'?b]# nUɃ:j(,uT= 1?GoGF_3'ԃvʼnKu%P1_e쎮%9#]ñ*f7}r]OW ]R'PnvMݕJ/C m @*K&MM_xkj⾻]Hׁn|^vw962&!fSC)TR(kvTҝR$  nRRK xvTNѢA ,U  mA`@"IGiIxmM&؜}DlP̈ Hlh7U;0XY iy҄-<$D2w+VU,̰F k%̪:PIW45|GXE ԟec2"tSF |ଫJE|-RBt+{D7 ګ Ϛ&`!譟k76LhmLXfir/|$E/q&>pH6s~I9'F/\!]k*UY oI3Wi.؎lV0 d#tçua^^)It7x̣}bPHY eGAۜ ++ߪi^nE'.ytXG\5Ҟ-m)U>߹e7 []xZ8= $tSHyPJ[~UB'ǐa=lUéb r2pҼDpYrA?]N f}`ҕ_vK!].ˌt8XtYBMNu߰_ d(\KB㴓L$+$ٚ΅Kiy>*aӤȖ\$ 7)H&ozU0tN=ip68d HmAJΦ*YZ LB+Rr9q_Wk[bSh[*"k/sooԉ\vb-DN/SpfSc2RIG2_~U'q(M&Ȫ&uuNl  +lzA ) vd1[XZDcsY&~B0Cm4{K\\<7o< ҉6GX{l|%]f>}R15z2|A'uk*ǝk*EO׉Qk# ф:uiHMHE$oG$IcO|]1 9:Qefh<yAHgeSjnń W>Ԕw[ܪXXe E:DlFdi*0 e\ZPfGgj by+[Pn~ Hl MXɦ[iN1t ٙ&x7֥braHix+esQx?RZN[;3*}~]-4FODV܇w|j>c}0d3= =(WMFJtb."jIlG%~%(8E>n5 %HK9jB_(A ietJ98*}7irT_APFl/o0߻ ʑqfR it@ HdF`Aqޞu{18C-y4'\~",糿()LMPMY?k0x HdSUZr4+ef{98}lz%5I&)"DUD sH]i3k̰#y*pSNJt|=ҟ_Iah-> hW3)(xGI!ٛw 5!őh {g=o5U1b}ܾV)[M4$|'Q"EvW$q 5rwV{x:ky_ޢw-IWY[#!$mpR1AzHϜ{=aj ȦP\^KE+VA;:<3HƧc`(Z#})F&wp'D.hb$ADOGWǝzd~U$2 f/س@-f(XYÉQVWB톇E%:"PQG=gʩ{P?o7M6@4<+8eP_J욽7T9WlO5~}]4FAP_QY>ߖW? /k=pLzE{T[>2O2p}F"3h6z }kimNn`|Wccy,vx-w^Пc5UUCYJ7^Ѓ@m6^B Y* ]@MJ>d>e8> /vDttn2Į_䮇rPҥ,5|~܏F^'\8nc#nۋ(F oIrpT)6gߤTPԥ2,d» Fp3~-Z]K98ʎ&ȎDϙktZ|-e\ʘ'%[IWHVXv AVe.΄WAAbR.M|9qdۓF NKvb? G #9p/zkB#mUW榞y^d 1u}$fR@z%#=,²APD,6pV9dn.crLޢԒY\&-HwnCU*E! lƉtVKA#ͱO 43{ގhBv].<8Tԁsc4OI 1K#G5{'"ķg={~n9[Uٞί >"zGJ)^95rWj%Tuu`=n헔4ajNvj+"ߋ3w1.\ <|wHX1҅إ/X$g'Zvs?PlF2eLs7f'jIT@t6qP[Sזo'S0,gn2`Q)"(6~+6N/ Mgj1btmG[P y뙺#X0p$AL# 7M8C+*+gdI b[H\C%6= &nGm!X^_fNfQw_, (R]!`pJE 710y䲽{!{B, G =BS(ОJчnx^UV\@H׆) VrC0$hĸ=!e\!n`6r0~a2o{/3;XK5X^uY q (՛~@jwLR1aOW!,tNoʍhgHWH¡~d`Xɽ8.fSw_7-18;tt&rK:qT9z09ʴAٶP:5>;8{NE8Mt0ʷLH]y"LvZ dAɋ=/UliwN1!WwyXS1Y.?mL- R]!7l`HH6ǁHiTfcaƲv'oĩ'Y?:q(4F$hHR Yf/S@ Ѭv.i2li}Rx.SwEXw^2ڎS[VHi{yot=~)Lf#n_3_hPp_f&7SR"u~Dd 3O(Z>`Zd/Kp6`OR~zy륕6pJwJĊ奥aK tM3!3  ̊ +WL^h2{;Pķ%R\~mN15ew͔asF> c~E57f.&b%0vXySt44FښjxXa:jӀ9Q_Ϭ??YGʥ0#}S{PΈn!V/I]o{7Eeg]bdV;t^RVo&{,zi jFMUs\ZNk;8/32s7BЈe'Ƴ*$Z|qLFտP{'ck N̳F;,Ŧ,co/TQ&{H~8;r.rWQ"|rqD ݗ?"3:35r? nToRuVϦ;Y_vuzA%,x_ ໫m/M7bJ-כFʃmY:bhy6>N҃cx .iΉU)S bJx ĥܞ[L;8~53,H, Lv]O N$m V}[:/>l7K- `񠰞5HO wmɖ_%+G\PxSԄ"}xX\3$o֞Yң QձňX!A&ʑG嘣!=Fƻj`n*Kf-Z4uV)Eۋy+<7va2З}?~'a,6>e>mβ^ʒ{b~Sa ~WS7&nE~nYU I1=!dnJ)L9B:^g9''\yݗ#D;KT)j|O ܺI=Q= 잽 ر"uy|NRz@`o8y!9Y Ktr9@pT`YLBA qǽu @</Sk,ix[Ω@V`'6ka 893uɮQ!_ p4&ˍkmڅ\hLWPZpr0jGXi %ē?B{,CzpUm£ t{݉C= pO5۠I(,l 8YNgCr<ֹQr\MDrӰB" &B㴣^QBgY(}^?ٛ|/zk1@/f%tV?a[@Rz$GS҆\fn9=,Z{r~c?߭kLyFxZykhS~W\ gSk-@FJB(Fhuǿ2#:%|5Qc<~$"ov6Ko?MuRaBɞhGTR= 8e$E8{=3E( y9Ԡe?gy5!6]iz 1܃TTΈs)= ̒KK= z#bDX<\'&#ˎ Sɲ ,#keL8zŖAt`TF 兂b;Em*-C'Nw~l3XYj:Wl~u ]Zݖ~M/в?BɎ2`Bs[MJKO?GOE'k~>7US3M֣i€oav7bn8#s6^K1F?D[Y7e,!iVfJde~PׇoLr$ PT8վZ y -D?ՉQӕ8ԩac3/ dh!` L+F>~l/P7f߁pSmgdbւ*15&lUU`μuM KS/SKp@-G vߨ CZM1B믠x[Z%Ͳؚ &glEXJA1]WcY# ˘T fxPKZu)"^u?i5>X_} 嵧)̋>=# d ` ׾G?%J-&FE5HJ_tԄCWA0sڻd!AFȣg%?@̼7z .<ʁOIӄ|3վ}jW3Ьh oγ˶jX]>(b Cr[ģg왥R) Eh:x0RֵR) )A78!\-rxi79o*cٲv0y1L-,w+~?pz s*ײ@Sv<`.:57 lDؕ.۔be!k%/,?~Jّ1.foEˊePjP)X_X٦HyIaGSC|p;N2:5AYu+&5Cםg&F#|T`_bne!c;&ɢ> KՎ34~@7|C`'ajG?ټ)wY ZM-b'ǯnw.wk[f-V6!ˈcE<3l yľ/BQHBvZN% imߥy2Yc0Ɇ9OMm>^ٮX ,e^\`~ύ EpZ;׳ 1fy90 k <%iͣRnHb~Y2sn[D¿݊̕ MbLw'c}K ᠘4l$RX(5Fr6qNcT&Ufmt{/),=dµ0D@.(6AqnP-MCe#"O7GWj cT: =;un}x*-b{{"lnq%N-??SϢܫFB%unZd:4/ub-RN?! tչpKz8J:HDY8Kc;Ko$H,@msN1WuFotwMh6?m=.ӮHo{*χ6;汲(ulxܑIj̵6WfC dO{`;a mo*+v8>6gA51V׎~%<Y0 Pb'4xD!F)% ج +듀"C#? x dܹai=+9t{pd&AYqC\?^zƒJْKGay 蝗rkR3+>Y YXW^[2Y|?]*#ky V` 8M#䜅%}%O}|*Ѽ>qM,Ǵ/Ploj̡%A掀:@t,#p7]3!}[``:Ć'"CUmmi4HU{I/PQ,)qFQToaC0ſ71}?]}-.29#f?ݼnCCO1ݼzk4KMﳑ+Vg-Ě"+ITEb,2AxѢ95Cg:AOE l6DRpg>uSYRd{]rwwzJ$*])[~PoUB0Lu|-`qem x%^fШFܝi%}/N[ǥ~>W+줘JGCiq@ oC[ D.M ª#~Bluo[%M&)W[s/,v#m7A k?yI:QC-"S/$m.BC-;@{*`IX@Ǫeg:ykshN>3w*_ Tɋ,$XQqL$ <˫&<}L'*܋=9mk=l4kN{e]Hc?U}X#~_@WQ4Bg{5CaabN6 "5R4D25&%αMj8_ lDrفF}b;Oi ~I+ZPNUG<찖y:w>@*]WOŭhA= = Ee%{t"Ҙֿȟ]Pjyѻ|첦s^E6[+/Lw_E(LtWD\)w;<8h}8ZZRkSX+15r `q/vG^Z{8 QCO,lT2aR| rltn2LoL3rRc/Ez=cM|R7TGG?ŦnXpX &b}@L=`)^B CgREtegFˠV7ccM<-e^WiC̑&&5b Y'-$TQ 1{΢Y#LQGKe'wGs`i%sk 5\ 4 Ϻ&hZr4Fss c7MeV s/; frư6_|/ZY',B_ mZ.5+;屢 W~јvMZʜAL ٶ}8!UF;^jpY̥զ‡'T hgfi[ܵE"-vDJZamq|T0t3 YYF}ѨM˼45W6c ҝ^-k 2oQ}ej.).Kȟ5dy}O~$_(>~r.T"{09W+^u<6 ^rKݢ>˲a:_`^΋~j\'__[A;A8 9rk)+4M4dbCY;k"U'A ˫PR`ν瘫nkF{Љmϒ  1 =GhZ _'.5<*ѝ@.G$+jmF p,.#RVIgL6pYt+Y)c q]B=ԝAUHmΐ\m[KDt- 󹫥 ϰ'βP~|Jjw%ES#\,a[32mNh 2_Exq[iTFl뤆5idIgQ˔y dWP5]Zsmuܜ_QBAJ`);f0Ƞ{IzgWlJVFbf B/,1Y.PU\1 <{ BEL땗^vDY 4Po!w{;e#d2[}AXW'(dLgI\jQZF(y1vr|k Mab&9x(uc*))0uaLLɃugĎn߽t;bH~T$X utTαn&/Sp@GFJ%d]=*ȃKsʐK`Yϙ Ok cTWÎ?zTW?z;=ܺh/͟6[Ã+*k-d ;p!'Ib=wxKCix.P[8A$Ugxdc.X#Ԫk d J6M,#OI?" (kuOLwPae_pcΈg_9*DوX.6rLO^ukэGc8%-h CoQ \:O:aPeZ(=$n%y> H'odbg 0? ^0T 3ˏ_{C.3h4"DTLCՎw }iĤϧQ- { ?񙴍;x,n2:ڡHpRlxݓDhp wrK=9`tTGHe2n-bN{u׭+ޛtbl[~pnH\W}q2v=^7;ؒ2z"w}::C5VʒGbUyL`M= t=IHݯ0UN\na'3ju+?E,s%qWt^")taigMMDfOV x /bݍ|aQ2JK{hjlhbk|*>C: !nܲI^U)Z&])ʚ̾2q&DJzY/B<1GY+ >>}3S ᾟ$h"Xg %C;Hdx//ppɲ$,Xi@nNNxG'bp6e1(Rm*\jUje)~ “fLʚAL%PGdXSKB{t3Qv99 *uo=bك%sqG(mnn6ߒtWN M̌u"ce)`AZLMz׵2::MgV8 RVW?:&Rρ *4̘JBaOiQϹ4!lH/Kv3jJ_Wnq޸7`5WvW;Sm7ǖLU6 U$4 < {kDQ {VXZf'z G9w\ZUөS$pd3qu#xD,bf~lW. [EAwٮύ+^fgB0C2_9^m2.QjWO; fjNfB.x]ɀL=0X{S+%bx̫) P;SjVWO8QJe9!+$P N'W@K\spltL!m%LF }fAkK+2SDc!/uVD =SB=:}͏\F ?. o:90Dh.- 'e?@3ֈ[atAZ~uYIaQz"@{LuϤZs=X` %Fڒ`ֺ ߃vC#xwh5l9p(Yp~SjPCJ=ϫ}= 6g*?Y |E8)Sݠj f W#-ޙ4jwu1hZ硪&k3-\Sүe;t0yJ=5b&flt8dbzN bΓ? Me ̠Q}Lj"YZ/NS`SC c١rꃿi! )7=OKrf%D4}v΋((O_%Gns\L.Kv8- _TNȼߏk/g|_ ; VFMN;e{>t;K sG\{DӼOWnnQ!$|v/ۆ.L[v( yqIm[Â0{n=RؖdF85a뱌-\$71Si ;G3`㣑l-VɈr@޽ 3,6B*˷AH]qq)pf9.-XM_K/eΝlҨ'=ʀZK0m&H~(he Ui74`e8r wy~  n '`H ة=e~2qH=)P:g--q}esp"3:ɿݫ1Y?"'*k~i @w} eL WM:nF4!Jq(3;|YxzȬɖȅ<-EJ1An8[4])dP,T6^%G0myH=/ Mst7 Ǒs@Tf-dzS14LI"_@Pl6I"~K42ӓVx^^8B^Jb$"k;ߜ=+gYlpfLa/ܠqi4(r86b~p BA_/W˥NU׵Z2,<]!f"7f~K|J B#Y T_r؃ɘ !V,y53m5 $Z/ Hwz+`!.~H? U5uaK:AY%QH۱;"IUA8)7t,5!kXK.yX(W!I{d0 FY0.DcRѠSX Ts̟TOJ:Jw Ke06|9{ф8r!BEB$9txO! nR;%] -h2Mt|.&Gۣ>9K L-`v/YZ7|Ӫ&LkɱݻTөlmi|^aDkf=d҃⦌M@p) d9k#A3Hv+tcE)l&3&KL*UcJJIzֆ+ 'qxLWyB PPGEҗV:?L',Cl*"a\RLX>JzeP,}Uf"-jV D@FWGL5,=t4YIm'J?)Mk9nFԮWBheBhM:ct9i5Re%G >V*mOV'aHi1ETsh'Q런%UeE_yF8P)O7m8WBNZ[ OYlk$g#ۗXH,G#f Ֆ]m&֦WĪ/2#Er*6a_WF#w[q&zfEDV(m:F Mq= a=N--u`'s xA:qL 눇HЊЦZ=Yma-8=~C nK9WKD}ٵp*E-/~ȭMKts4<.<Ǵ'EMhpڟ+$20^mro/G橠K$́42A&~zS %wpnßwǁ-E`ј2BB"tZ~{uQc6ԑ&D U-nnY4Ǥpvsީ7kS*EhK)[%\Wd-I4z?4G&Hdt, %QcT04d.e`ETS 71BDy5\GSǸA$wgQI\hYQtr }D˕?LzDjQ%γq:4/>$*B?o%߀-Ny̥цzj}*m|rhiAAͤ80B6Za<˩)i9|^|P^>b!eC/Evx_;_Tz;=TUuߚXOiJxo׻7d5kUĘehO7=qt](ŷ5TsP 8HC!X|ءR E g!};_@L,H\({a"𺱎 ]yŅ `BО((U1@`* :ZW_ixcH@alѳgG9{{]P'/.5nh^QW&uWBğ@αb+;a`0 }#Z fvBz*]E_'Xb/@h"gu*H Zа!&t'b`1h鹶^џy|;ɅA`=1Ɵ#3 z Y%qW3g JzCk/oʐ Kga.$>}?Д,шa7;4pߢ2I6Ҹy Gsɐ0_ԽuRY ,=f)BivUKYJ8W 6ʷ0IҌҢGlW;b3Ђ tLߩ.A>:6WD3C _2л┓ &7J.,^`&޻N|Uka89"WUȡLSiAƟ̉ʀ-{dAϫr& &h nWXH7e/x׳ݾJگy%I+h 2]3be3EBdOKOJUJzf7fL*dG0^K% q,?+d`>+0fVFv'4zCIORZ^):'u>pT >\OY5atG!I&z8`Jx/!70h MЬu.n2Kn0%2Be \.¾ mF]}yaHCz^#_ ),F]B=MT. `rￖdx+|l0y[1CXx`[=~q 3ܒzW p5b,s9`͇Q|s6Smi W~Y:jzұH9ZVGƋ_U#\ ulʦUÂ?a,jR19j4`XN|Cͪs#|~9Mۿ8oKFU!_00sQ-)dp9n>RxMX ="`H= @Oz#**#3UE}㧮'&chR/6T"B\b"=p"xhgI=4|rTSPڤBU}V?1LrziЄhkLsSjQy@(^;?[7ي_WR/EE~],.Yػ*y>JUI.'q.;DG~6s 0tg68KmG=q;w#YfVTFEP=jh&XL Zs_<8[MCm6eCb?NOl/ڄ\"BH&fhl!׶O4ِeG:#OKpS9Qx/6b*P' ou#A^A23ې#&]7t+ε]imA8|C- nHa=VG׼p x/o0C#g0 7PD9ehE(FsSxdw6Us ݅zHYH,B/,AA蔠R!Q~lL8mo9m @~j=j9]HlyUoӗ 4r|."dUeG9Z7thJ_,DZ& 3lU40*b@F ̎D]VbzrC!`ƥMߔVSVO"'Aƒnb<@aiL(lJ%oa|WX|;^"+MՎ$Z{~4yBpGURO90^0 B*1i3rYbӆ.iŊSwq&fmݙW1IZ)zT ֕~f[#`Xsɜ1uvHd46Dg t爙ѐ(\bW^/5_ĒTT?Mvi\Şiz!.o($,B.Ex] 6,y-?e̮fRV[#%$u+l)gez m,Glz%) qSG(Q_mt$P5n -K$87q?*g;1qՅ3zK/}Ds]{i_H# LfHf5WkzT hMv 1+SkPޥwuIdgwߔ!hV:U'2iKw |*ΖMFoXaIe,O^lwF]q(=+os/4| ^W ߼tNALJ)ngvzjKx_~2up9{' MEqC9vٌDH4eqwMGw|B%qĖt>t沯)蟵=NtRB将H$2|3mrpYT;kuR/m"<@1$2wӗMgXDN[ ?q^Zڣ.ڂo)ȶQ $rQh.48!W3,梸o O8㵪f*!M"gl K=xNTa@X\ǍuG~{tBY&7vr55;A t{[_T.(--^6 Af`yf'<]<_Z,k XQwZ\_q*: q"ķ( 98׭ 7SӂhYKk'$Y9kUKUQ=co{3. lTBkyz,I&9 NhDN);A̟\}\%ߘ,l#{.# B&b3S`lr,ρ'fj!?ܶoS#f;668i8tJ\^4zzIXbx+jAEl vfzt_Q:oi>e[Y .b=,z) .NB_Q!mAy68gEa FMiu( tg=Խİlpr̓tbs|X`6Gp54ST\D7|S{{Ɋ .%F5I1jdTAMlƇZ<їπa@nl0]߈~U! 45 o%ナ~||.fc"{߇K텃e7۞\7U1L`|# mIdkBP'Da]%w:o=E"צqrڐ/ɱgtO/ C yE}/LQmvA98]A* .qfT+EaĆ-~vEYs =3+WD4#Hd<]X3}f^W@ʍF @ XK^Gwc!m`u9MؾC' s.(6kp2 D]u&Xd!, h0xF SoϢ(oYՃ7-j T~oӇBGz1ia_[gQ z~3w+Kٛ\~#Qi~YS(PVz*S9?XcF5%헳\0qc8J-Tx;&Ex5gRcg1޻Lg,qkJNGfM8FMpE &/`(LN/@TLA/ezy&]dܐG5O 2? -ksrRqa.U}#~ CDF5<[]L]k䕔Dʾ߳NLլ|]h2Œ~I_h?]r[50\j/v9񽳻R(^M|,yAWWExz^]L{Vd.~y{oc, L?'#o]탍O4Eq+2vAU!̭F*<'EfS(8L|*N㢹@vM9o&%]dq`vWm( P%b$,|я 'aajh܅0!|40\PO]*ޑтܹiY 왽(bQ: ᄮB6֑ѥYg ĸV-@^qct~xbe-Yg6am6`4Jg~ arm)a_$:6G OdpN\v )( î!4i]YkIR2X `!oԬU=K<|^#Z^N7qFʹT1;9Yq;%`ԆWxL1mm9UO V:lmg*U%`ܿ$ɉTAϒOM:a#ZF5PjeeDo61s0gw~!Qޮ ѯ CX%\S!~JLd)"tR'Tj-X]k$2Fߌv⦍Y4mv}O XZq [뙥DeXoZX/T˪ w6L^k\u^^ۿsFB`u%92r"T:~:@Wդoy1u#Wd9#m`7Hg.U!q?Hj*Afʖppr$C8g;F8 FW@d CeƬN{rG&cP 'iƪC9iYwe/zhAKNJDQ~S3;n_XB/ )c幘#XZ0.FDee<0.dUhZ*)TZ$0հCEwN9 8&x>(z(A݋iC6|̶ٰ&{0',`DX%Q$ )2mF@auC 1}I1Z7mM8fu7_f+zDN2FJ(ė!;rlQ57yH:\Q1?48QhjVCt}81o5=. %5 <fޤ}2وY<g%RU BpYQMY@kk֤y~Q/ݾ%ZHcbfNqVu].w !Y ona=i*"ZEvds7/̥0&+綌FL}֠hj$$=I򟛧# 3 sh"WV 넌}*+#*[MPar6m֘xLԍH^6eгm`F>n[Gws YgV9LfR{q/P إ'fhg J/v70^(x, ꚝJ[B QЇִ(B\}4aSJ8y7$ ZhHVCwB|]j-:2釣ف~h6bh,+Q?AKBA X>j|&Ϛv n ͅ`M,%}#cëI Ӯ :u %UiuNiJQ1HEWSyᒕihä"xV!JQ6M 8?̹: ^N'.2yT{W(p9),9{Y$7MH~!컨FadBAVjv@^v 7/lɭ%R삿^,`SIn1|eڽKv-GtS'BP,NQ  `a]@7*H^M,feRkOa8H?KEʠ[&\XRL)xQc0cMDy=h1oȿ.z_Vr4l ݤ6!U \cVoT1 M0+bFh G4a0֢4E&xOݲ,$ z7f-j'ljtAjn|#2]q{wӕ!in[2-oxɝd19@a()"/Z׾ti*9ݐIT4# a}d򜒏|b &nYʒTO)299W ωŽE{7eř?T^yWOCIJǙ">RGܶ ]rB\7pBKe%;x)O*\y0&pƄ#Rዽ%N/ k:vpk!1l}Q00be~J y!v["Tw UrFӒH{ĕ?E |r% WfWTչ\^`K<,kwV,X\ M$ ⡓hG[Fz % [ ]$=e&Mmu C.xm٫caظ,8r֗k~:'BBQ9e]7I%Rٯ Cԩ:d[Wj(!# JϏ:> \G >Eg]q_s+@d?NfstNY7*O5aPqؤlȊ➆\[-RL7wtl3<.[CrbCMS[`ia5S^4AβpH]t?CJsCZkD}FpMҔ;&nCOTqU+)"ia ^pk-P  ~_һn*0lǡ(U2uU:ypۅiLFZv  DJmk1 *+*Q_,Qj!|3A*վkQ[)^G3O7RHw2D}uN 䩍^7| @" M$OrLEv,0Բs~M xw߱# kTeXihʋS9&<*h~vTR }vGO{k ub *9+Vũ+y'O%Y#2XC3o.2|np5K^%-ZPai]31\OS.JA6 +.k4KNGB W!s¥58J6 зI@Y \a مg&0i={hkсq7 ^IY zXTr4uˁ f1sVȚaQJиCֵFMc -&GM,*_uT):KBU<8A(uT()Vُ"uvͬpLZǗjn'\cp&*ۮp20´K3m%&הLj[(}yjnQZ Y,&팗ޱ"涅N?ݓ{/wfee=J~N8ЃHS(P CC5'u3ׄz}Px$hhLUE8h?|39VxOS2o ji" S?%MqoҐJC2f+0ۆCU^@~~7qr%E׻fȧ|[WIS蘭g 9[7Y1U Clw^Hsg-kCBZ .=UG y2azdV[ r2@*/̔s5~8FRxnn9L+9G*0o>_0>4;.OGrZb|WW -(oo[,}`ҐEI>tx$-`bh+ce%7vi#rfu=`Žj\ EI͒ 4ZFfH@zdy|?B{}]gyr,"BeZV)xlF$/~zoy2E ۨ4ƀ,[ Fj]9"SWIk"&>{{V%THId6k2hN.@DSe{LVbުfB@Zvi]b2^ Lf+U_ޏp]X r2'&iw"tcҍv,O߹ <.w'>Hkeo}<G8=ޙ,LZpzFEc^ du R4r ^;W)իEE*Qɵj}p5^hȖ 6`w`MXwi&rS-} blIQr:p-j8I-_0]ge6 $u*JwR%`H[dz}3qРqw:dȰG-9a<=|g1c]6 ;hGD(781)a568ntFةQsuq yP]eph6|פ9x""g"`#l擄r: ۙ\CcY\yq\ r'bl2htL[\^BYZ*.Pv gljDv15BZ+|ei$r R>ی"́z80ts bjh=(ɗڥOH,-LGƁ긡2-J?I!-r%q{8p =/i(\cdvH z [i0ω'ǥZͷspʿ;>1KH,vlք;9#Fᢳ Cbt=O5<5߈_.Iq%C+ ${LÙ6f$;^S5! _g(xY MJc.4{GRjPkdWF2}M>Ś>.IլLxDz!kX_@q[ԎO9f" ˣmr 7Yp"]V:Bc^&P S-Sr02 rx~J%~ݱe>P뺡 T.nұgg\"`MLo8ʱ!Lld0iwﴴD[ ֺ6[䴻ʋ-F(W<շ ?Al]6<ߛL3OUm*ZW.)1Sc \Ůf|4kW遮iɖsrɪ`Y)x.F*WR{JnҼY~ 9׻МE XZQX}] !=U[7tT}>-̙|{h]jO,ˏzvYZTi85\(fj5 t`83ۆ{U5/='=FKu>$H>G\:Ye޽*=#9@|U#97yOhQocly \60:}[V;J? ޥGJ0)q2L uH=0?\轫_205,A#G{@g7Xs^NiHd]YR#OZ31UmG2jb씼i3< d0-1c(7?/`,7YLM(xTLڞߒ][R]fDQOb֒)f6H vGg^JUITƍwOo&ˁGў?$i! \?]/~T*85i3ԋ r:Ekamxĵ?I>CrT/ޚI:lFQü2O1*-%Aꮻr K=?JrSMU$3n;៌6?J,:s:yD!~} pޥ *~ @&szfj5 ߜKBW}E%ս;TִUr]*faޔia`NKǍe1l`n`0kzwz~ K(7`5Q45YL̲e@" TpQ(oY\&)WWӻf`+Lt7v!Bh3e5pUk~R" }k{rMz:i/Kerʪ`e_3gPO2yʞ4jO| _zzaD-q+ xss\Qr3H&xG\+u0ZYn0dZ.( 7c,R;1'q!L}N7ρmWo'nMwO'VdJc坉Qo5i"t|Ne $;޹Ky`nfjt~Zk.3WݹA.ů]Aђ}oG!:AxmLxX0[n¤ 3ܢ3T"2g$cmx̀s_--C] QDT|` PP1&̻̽QPč %VK~YG|Aux!VY?eG{Ո2-Y[2"^J>ۉA\o uHTak/ȵf9m;+ttlW.301z_5(1ZP@2,63nl;v/]U;]=ٺhъjO~Ο9  YEC;̄s|t>0B"#[:gb0\:H̷JFkߟX)tRGf CaV+iQ *i^d7SLhMгhs(wtps^ E1l9v6AJ{NAT"F@QvQs24vxeɱەxXtRr4`eF铨j2EM%S]g0 *ՠ`m:rI|;_ vZ{B) < @k }%o/_P7 ^/σ:̥?Z~±vܽp\H~m[쑾.ہg$mϯ /#F3:7S>2n#C! \P%{? n!8Q*&>d 0K;QNp9Fn+hK)3_an&>ԀXv:2?jYnN'5Zl ']Ce E-Ck5&8* Xap 0~ ͯ4N+eEfcgr< d#aH-aݞ%eY# ,Q~2;8m HC j/k"XdoD•Aԡt QѸYnV^RnɞZ(&5=a߿݅cGonMYvn<, h)VN @=kJUlrFnNn3/?HP ƍP_?0UHGߝ#b;l {[O>sB?YlG8ɪIw4Dh:G|}M̀b T1>L7 ;ȼe9'W{Syqs]ʣR|-˰4:&c~뇝Cj_$Nau FeCHi. ԥ8p#ydJ''+;q+ҏg^^6msf3*5|>դ]TIXOʦыaE&A T]$96S_nУTJo;報EP  lcjt hteҋO<^$;GAD)N_ r8Mx_)<)r|.:m6;ItV9hP֛W̴wÊ9GI4\۽_:GF%b֔G`D߼DV[}v8PY%f!:Nݧ8V\mݷI'宵ԸЎ-5}4Yŀ2q'cpBDZֱ\*|>Az)`2I91Rcl >Usi|9ւEL*ˮ5!Tb9{bvL&"*er{d03ؒ7W\9{J΄:͓b[ o,`39iUl*҄z}ǝfI\eEuj;}u p|u6x ~zg8<.g^H`h\4F!Ьbd.0V`j7F)ob42Go b4*2=,Q2 97[ $<#OK''TG%zEil::)[B>q򚫺.,tu.7-;Źl*fYG2XM7#`a/=b4s#G*Zd?z`7lODF3tX˩uKԇZ㲶=[HY׎PD6eH45Lu! 8SD:ð*:Ͼ#AQC-c˪c$óʄ,̞1~ ":(mɉKY.|օ_8|hG&3K"fDߠN62*y,b _%i6{@UA 8viO*BrJnpCNV~3Gb8K"{qMJ7a[r+]fAB2+vf;+ueWç jJS=ehSHFBs +>Hs\_d *}dxoOYZ] @7 E tW2Eaۀ!ޢʓM#T?ABmb9oGRNbu/߉#iRsM9 Zﺟ2cQ>}G3H7@[ 4\쾳u;N%&-~/PȰz ..nYDefHEB>q ZR/\:`$*h6A$V՘ݍ]nL0)<SM'~J t,%q;4^Lgk!]pQTx qy beȃ˫:)QÜELtr:֑#˭MjovndO@vk&Kˌ#q4L d7fm6/HUGR-wo,O_O31QH|\`Q@hI\ER˥Ak~!`d?*FOrn@t'FlPâQ+&`b=Kď&h)0W5r`XqybR4Gxq,C89GMo_FSF-5K/ bɢV/_"M1+;"Spr)Nˡ%f)A]Ky9Z V?ĖԸB[^NY H$,q?5:.zYխ-έxZ:F-x^Xld#[g+b5߷!~*sꛬY-E:0^d$b&-Y!CϹh)2zBFaMQf;Ϊ;Dq`,ǔpOk>dqI[/Iu'% LA/gKoW`)f n*Im$MՕgAۤ@=ѵZH'C%TGh|>-N vkӾˋ]HuLkp% &G܋~/ߌڽچ "BTkй#021D2ޓ`Cq%ޟS1x$]%m+%<>ћn]0rX, FqeG*Ae()bϮ{~#|-X}BkK3[<z?pa?QnyYgqi42}ja]l@_dӷSxbz(ND CitQipާfJP IkɅʇalJAf_{'`Qdmܟw䗠Lr8f){S<:eyj\8n3y PaztWmYVz7(H?a7(ߍ[ -S9XF04ևH iq.dxۓ7Uy/Tg?0}Hgۻ:K%~V쒲Rvиr8N0i-FPǿ@j.򢆚!Pg/pK"> ߜ=yƃ*הŖ3#΋G6azʒ/ZA>".y(N[X ;WXu%}R~\}]+M/i`!,>5Z"xn\mϓ#(_FՕSJgņG"[._?yи}I.AN9*("M7 ΂5HI~Β/Ձό'^ļjUu_4B]h`<ЕghldS/hxPʟryswi+~.tю({!$;ޙlXI`zޢ**uu- *줺W*o/_-؟EcbٹTpf(*)Ge*ғ`ی0W/!nӸqY7 lӁ.R5/ad~pM9#/yx m@ ls&OW+GTt2,,=zE@#n\kwizMu0 UTY$`a=]53xyp/-T8mi6uu]FVn\1})&n.=JȪ -%Iy1Hxye~˴tLn *]z4Knm3(cO3Pe)\ףPW-C|6E za^]$'P6f!l#|FvJ\UA='gj,y1`$uMf$9\|Ѱê6MTs90 $0z&\9ؐ||1|OUsF1Bᥘ[8|z%_] c$.([jI޸hݫ=}/Cw.ȆD: Mj&[)lե5vCeK\ͣ?h*\A{-|LL-ЩF3w|bz2-fRDρ%7KGw['xqQ6)(/W/tAF0ώc߄ IFZOi \ &I{`dYb2$R&^w%V,~ -"咍?Ûx:-}~?*\g=j*5rհBL=fuND:oVT.~2jmneN7khe"׾s/`-b 5JGT#M3EA^FDہr@jI%@NE8rZ#)Y=z3c|! Fw`P,-loSZd"R&9̒E:[sd,Xwo{+)kh[ qW_q\8 bЦ[}d^ X sl+I1B:đ(RP#YG{}i~@auS!w=/& umA\wcjB0yj3X\"բ>/FΫŋ<!_\Ul}-t/hE/7y.p'BC`bߊ!YƜR*fdFefj%>MoUҢQ;zm2;xD<"N KZ&UM݃bF!9{(]x/xR[g B묢sjjT(쫸R< ,$Z .`hO~?KeKt(Z#F˹O[?E3pwkMU#^6~wuRW$#*4Ӟt'#H]bL<(ApBLޕmO/ ~@%8>Xn;?o5T|a a:]FiS{ь`⫵erzl:95%29VGHcT\dݷ3c|Gb@ZmR,7ekKm <ɂs%j?~x3bRw S^KϺ?ٞr8?"RE:&n*6r+j5I=n䃁35}fTfWk{,{5D(֍k"tnnh2i"=uA&O3ig"Ym+Q(sVW0V a* 7~3'1|医buAGq0tn84(sw<8,p bWrțdndѭD;iMte xSM@#Ls .-IvÁEDuNdO&,_+R'v\x>mww*$b6u RcsT!c|cTwm(syww># OM6'?_4񉆲fM_晴 -5js=d7,N[m<8`Ę)۬s7VM;a=rHY5|u>FL&^n;ziL~Y:|rj>N8R3"ѐfdtuĒJVnʤSüԘYp0MrG̯c Q+Z"ā%gi3;fmU7y;;ͭΜx#aY4a J$$pJJ0W+q͈g?`xgrBͺ{;/ݯ"g7+}so1`FIYBR/q,]l4 %f}U%UoB,Yr J!a= x/r~AcbLrMP zY m&eFV߶&Vg~QA؟0rk\bT.zTyto2 TsDiUopBЩj[F#i|6T3rg;:K_@?̺a'2ͅ^k}0H6yVo=_j''p\Nfoַ$m6B'CȦ&~$ 8`8sqv~a6 c8taEB?LXhm~|-̰y ICUn HUad3nko}-By z^7|xy1Rm r .%7*o6;fkP4P3f-37m,asvXV$Vzk4b,:p]!f˜FzmxLH,eM4Av FFm ?颋_\Gi$ _d<;0eNp2iWD#,tfkV̫'w?|잵M{R`H)ɬ>6a0H~E~g6 p'PN&U_>Tze@3,wqg-lW7Fҭ"&c<~W;e/7cZAR?fP((4Sͧ01 5pR +"#͗ 9-@]"g'+ՋT҇U0#e>4"-;F(IU#v(,ǏH_x,l`Q)jI9t_4Qcg7%~F|W)4t4`@$lʺ,]]u ihpjrV~~ϳ-^bNtT5<^(k+"ّ <*;?U*K/7Y%nDƔ WsMPićQiSDk_RgKhVfbp{z1d%L\U㚳 Tk},^>3>Dϰ^!HRMCk1qσч2jc-'mAH!Xb]^I9p [V]Xu 'Fnي(Sɭ?L>/yW3Z%\T<D:O’byT^G#ﱪY@ 7 X0uZz'!6֖$ Tq K 8KTajZȵDIg _R@+j|qPK mA, O`sW3@oԩ u(~9S'fP+kA  ='q1b1cYP9k~^%a($DڄDHaܦ{TьΈZCJ 8\И C:jV4@)Eie=iMͺ}6]9 [1y'?nG|K!P!Bn Bؤ̏q5YzVc',x1H>'h95sŘޓFڨYLOvݼ~>J}]IЈzzW#M3H H"=J!S~w,ar;9f8jTq7}U%g1:ݵe+@ 3,I/5T& 's{xa=̝X}'bDZxG$N "9:/S53vufI. c\fݑ3ݷ+_r']'â:ГCdS +sƁM!>P;AeL}9%̾'r9> b([+u~#ɻԌq{z<ͰXyHt|ʶ4asQA?'F@аCK]\Z7!Т9:K3;an)mԞ9SmS zj*o7ڦϮ6c/8&K'.R=vGMO/s+5pt[f N s%k ,5h phJ]t b>D )]"t+C'Vv/oo|K9 t+QՏr 5G=|Ю@!~C@~v:HI;ιq %/>" x%ha YO]UٳfE@6>Asj#1DSd\D}:fo>hP~H`KyR !"4/nhM_y|YItޣ)(!}pE T?; ՞=2N'$ O(FX"HG}7:L"oia\1>i O_ػ[4zq=\W.fH4ҋ-Nn!M|rn{=:^*=7ډ,vwSqC祈*sմ TK;υV'l66<|uDJ&{<фE|x+}XϓLLa3lDqydtÕ'w`gWW>WQ%tMqۋ/`MmUp:7Tvu-qۓ ]UehcOfzb&yD#녲Z4GqkbiZH{!,+tn<mDQjv$3Ǝz\ƚX5^w:(|@7fRBŇ_77呠B2B;f(\dW4RT{k*.-95zH^q?V,Í{ Edsd \ʿX|)͕}QIT1fD^7 k:CyF.꼮*l4cd&1\owCI^cA?= >r7WÊ{zl 3 }1w (ot6c[h(S"g);jthj8Nb& _Dkggbcrܔ3KMʓfxeܵBZ=7ƎB_9z:"L^}=mA^i,;ǽGb Pŷ_ e[#-_rT?t0rv`hI 0톬W.&,^؅D;X²BS2#*tD8 ZR ٶK[?*Zy)}+hnBE~I>uJ5 2Rsrا 8{[q7AJNIPnt7T.2DI:F,׳@D0d2CDaIR~z.D1u=>И)*P.u 7tbq o56LHH>JkhO5=1UųѰ{ӎW % w̆781إX ɟ8z>~!Oly٥08$0:DBwc*L)tM]BkoZTJ4EDQQLҿo ޣcV]/8#,XŐ"z`kŸ'˝L78vlPz9@ݍE=̬Ruh(ݲ57THMޛv6-1TFH4Zx6t_ oT镝]$pFUxDJfEXl]{-ylE:#`ekr@Aˠ~u՜,\z SX4lGus1ފ_']5DxЃJ+']Vf=]}-  A})/PGwH|ӂ̴3_}?KJz&{$tIAH<3!hHknKO.Vpͭ,i|6"/U[d,e2Ƶ-"DBhlBODž+r>ǰyA@jÿ |<0epz*U|RpQ =]sVb[d:<% gg2J<@?wER R{$EtJ+hҁ؆Rm C,έ̔0d@੆{HkұgZ=O'N C  Ԅ~_J:xO5/ Z]Mio~6kf_aY>  nOe LQTGn-5wxVbypiqM=.̙!2>"]yY#O"q9B f3\p;qJ>0v9uTE۫ˋCe s KG`q]fg?3/"7 n !CpPs. Dz; =_&_×tPV>Q2s HPǏO YvwلAa080_+! `yl KRHdn V>^`O,cXO&bg ٌi h $eqfy9mͶ8sb6;mELOMi|Ri+dSR=72("Q!f?3iRx2hҸvM bGN~ uY2X;NJ{8_4".+ae#?@fbࣜRQ$]-_?2c~A[n4rWZk|P~t^_Dpy Bj U*Ņ 0;yvV}3.0S:ab! EHuɨ(SA؂͸]\Y{ Tw-w 6lb rӐL >Qc P2Dk"EzXD(NRݤU_ LQr+uc !%pC\@\t#jqkH~863JʀtMw3NBQE:oτzBT*Z`0ڋ'jE?02! G?AEQ0fWM2-4hIǥ3: czCϘ,[>aT:_" ŏ:ZDq'0(y!&uMF;v9M ߹XL O\`_V1. _06$匧-H1pa ::njSB4(;t/ ?됪L zY$jЩuu!鴐~m-J_s Ns#PgkY *aE]f|)fm,r9Q4o`-Ri '.ָ:[\ĵ^C~3лa{L9ͰbDVO Z;zWDFKYǥFRAĬO?&oI^b]-eQqLxnmҒbjhrNQ{I4O],c5[_UmơYt6Bs;[%Lp01S}d:4H< V >F?rWj< _SBA fw)Ÿv(L}ʤ =X ԧ?}P^giSE)ϋ#,yNƝ,ͣe`o:zfYQgWǾ-6vT0oxT>8j KϨ΃@U10(bgu-94*oGbx3lޞ 1X=nvf6SWہԕ@@y!:z=Xɺ[^ue/IyV'Z٢߳hU}Dj*GI#ȜG 9kJz>iZm 1r wVU`%et:UyA2tgUU))<O9c]VL-сXC,wW"DT\Gwr`h/\RkZKn^x"g `O(rqVB-]fŧU;@mf!;/;A>8Kx1(rTv(Q9xF=E.o {ADM = 5wֆqd>UxT8"s_sF`VcA%G6הVuHXNyY]pyL^L2^٦%}j[=NC0HQ}E~<@/ٛD{uMr`(kN k`< 3I4Ϧu6m+>LZ{ >pΑ .\=o:@fፙsہ>=ϖNƞ}׌ WSVy>$U%%E+$,yeO4Ϗk-W2:B5l:GC$B(,ȏai3?)S.]I`qq#-1\sbu4"U&'EsNG/kpp%LIzI$:ΞhEF4I͞/'M KIs `r8&&n]'Wf`q{6ɀJTM Gj]f%(KiI{vnrj[ ai)BaԒ2y5)_׾U w۴UO#Bi8Ч!0uP!0yK,8c!tpPMaZ"`Ư-1׮6%[-xhV>M,WHܩN!']|Q|pw>Sם>ia>uۜc(N& $mB$S[LŇCƉƢ"8kQ >+FZSux(-vb1|D6pA qSqˢS ҏN7$o<ϻ~W8{8^0kĈ:x#^DħkzO~lE VNi4T׸ԧ؍AfS2}DeXOaO1|Jnz \y/4?ڡN}=6򅧵.?x 7M=5I0->Rc1oLb5i G):2$>N+ ̅875Ax^Mv D.˷䟩~(6g: D9 $_f1԰Yߧ ߦǨQHb9&sQ8ayvpaz3 nتM!Ֆw_gu+@}㋲$}6vDJNB=5L_nhg]e.v$"7^5VZ+iqxS|$x"Wccnx<^gyD=Fh bB砛P5ᢪ^3Ҏ_y>,ccbH]MwHpH%8'AzQ1L^e~zM1#ʅ* У OJ؞ߔ "4;!Exzj@|Ū  9imV`pMٝ6z|r/ E(')I¸\ ߊ0ƃ6߾.O`c)Ŗ. CFw !;+&]Lm*oUc;0 IPU jFL掻] ݙF4CEU6M:jphN^>8=4{ yF%mK\{YZia|_ބ'lCYSNN7lV4['x B(Tq z1rYA>j=W7j;y0R=b q&c c4> 1;)Iޚ3|XI+{\O6j~7.j{|MY!qOuD8bIBŧƒ~h ՔuJ?YQ!V@5զBg0+kXcx&TLͫ_N_&p &"q$#ͣS+t}]tF\&!h*7~VX~bfeg$w:UsHW*[cÐb 4FGsU]ap|cCoTXH^[>R eLkEmiT+XJ)t Y[ :eƙ u *$f39dwG(NA0r[3JEWPnpH'ZC } Uw xarb\I)CWL1yO Fs1ƲS& <gI5*I:;_Y<7ªH0-@?Dhhx gi]Ϳw c2Rdz)5se|r`^ e;m<(rb`=Q_94A:XW5%i蠈@9 ] C߂v0@0iV;Ha:@M/8#bMBcU Dpg$03F?hXEBBx̆죅}@{AtFJVW=nj,4vI@9J{c5gǑ`0Sҁ}iYyD(үCo~H9y}S~վmx3T+;9Tv +f fa9bLJ޾Kcl؂(*G+$>|~ec=L g8c3rtD,x O0 _[|Ɠ3,yx:.aNIg2;1SJa O~݃b*P&ﱣt4~ǫ{" k͆eiQZfI A>kf l=a3$#)-7ICgY"Z N%ecX3"R?,\NFv=;VېY@o4C68!rhi'CP҆nLa GZo+/9 ӎ͡]pTN=>K]v%RXa/la` P,#ڎvi_ &{>{=mvo,hrb/r 0+ts|TW^e;eK 8<}+Bxt 4 ?xE*Yެ? 9 rf{92mZ`cL@ʥ\:c~~ E)i=w:cd"N2A++~=8]Liey)O&Ng 0+QNaXVDK:yWp*A0C̶sGu nKG?Nrq{JXJ. rM*#/XhaG?>'Ml%j~ȁ7GH gՌ?``8C4 8RHzQ=Gɏ8NwE6eL"|wmّ.$h] :W\8R‡ћ@rBi;p|RNӨse_ҝ W[^ (̛D0lV[ 3UQ7NrK}k#TAɀ~:/lLwp9b/~J[U$heCvL01_FS}f(}z#zTn6PxU[ϙ9*:W 򨪾I`]|!R {)WkK}m3jz7 '`9[g%hAVBd@3ZaW rJ\nB28EnIqbUȐfty4$ 0ݮqNoRWb?'Y6 L{}I =")AOygJH  'T3`W_dX E zY\9gKI;7ܲ&'d@qj`ɟZ/&D ֢ʘ%D'h@y !qxM$[U j}d}wPиT;Wϖ4*Oޒ,Qi<rH3mԕ.7d\)svzTl3'lUW~5T*t%Ϳq'HDsg(,IJo#OkF-ypQ߹!h,>,Xiau u͠-Q $th?k"5M-#[#:֖)+xl_mUn$/xފmT =0)\pEP4Aap Z_F- &IqHr n3,[uky)YuMuMB%eѡiȍYqdsM}u5uZRռyiX0)^^C V1C6dzNɱf'k>c$ WF%[6܇;!KR$ Լ\8rD񫵖fpu/us3q< ss+I[ǧ}:) 1vhnB8(.~`ȩZjFHԡP %I[S5FLG;9jf.)LG1'>$L?,v}^q[}xmuQN ,3!x)#1e k}wd$ʆiQxzk"`6_Lç/!Y\laK1f#S'/B7|bRdН])}/RyJ؃\s;;AYVW)tz4_Lffi'5d2^,TwL+'j8mc}ٲH yP;_Ӷm_v}[ev u{IL!<8{%][Οgvuqc:M${7զZH0K& zP a? GwP(OOȿ3#v. ;W5u$YUh0z-_U8Ɣ3  e?-#! \!o|rVdZKNRTF$x4)RP卧vOȓI0F^SDC5|k:ܵ"[{ϔÍ:u-(OυlyTRF\U4I msz璟F {ԡDRN1Mo^Ȏ7:+P.L< }7kJʱ_1v{Fvv@L.aCI?meC:.&;Dd`*pF CxQsq9)vKi?O-hVQ-4m ࡐ)H΂FϮCGa)IRMӶ-x,kifȗ*\g9P*4BŧI IsCj.:HZ6F(U5'Y0xo$c| z |j;jB@[E:i‚] Sqwұ6Cy"cjwk+[$]<ڱx_!2\y]= 4FٟʂzyA_F}+^gZ{iBg~ ȗ:Iěc6lbRRzا3j X+ eTN:RruY"ްH=?cMehMCR:*X&u%[ S.dR"J#y\!.s5"~ cob,V]nƃSu*t`m3.~9$ÓUYf @]:v݂jFp_0#بG2DyNq},QH,J ҡe1v{8I0<",pJB8hM䐺Y7x:a=Cxff͘:GĿ/tMd:P5*mBI9ƿΜ+3>#&ȳy+_Mu\Ӌ/UQd%9@;h)X삯ſCN%‹Ӄ*PQ4j Bd4\fpHnV"'wȹW4F%vZBwFk`}6^fx+X >"o;$[ߋ~^(jYvudp?WX~H0@内Vi=陋f|;'cf؂ /0)\-LNmɄ]ZL,c3/i^Fq 7X+Jqx"P9{dV?DE imc 0S'^fw.wU`Xɼghp!+d{g+{tAl3+D [7T)ä'>LzƼNꬾSVyWJwpP1ta,6AX1RBgLu(?Pt{k8 oy=\QxSwrĖ8q>/a RI"Ms#&6O.s zv {lVCER?.Mj[Ta%az@Vڼ WHB i;$2ͼWyss!9]ߍF $Ch8x'( Adlߐڔ͒PCʳVTO|N* W1ihxya1j=:$m2)@kofF{~1@9d:wOCw. vqXDIm2O3-8He$@Ho$D^34 |[nӁy'.r_%O}&C}e+h,RO]Sl57BM mY?d) 9]d mu^ *2be4›Fi>cx׹S&zonĽ'+;$lylL7b *MNܑ'K4rppRhgv֋7coMrMП]I&l-@)p eMkP:NB,4h+`C*[]-~][b6o'խ1S>;4U$XS5f|hN!LqSk2fK\h5JJg$B#cC=!:ZyX6XNgQamٟf;Ybv5 l78*A-~woM OC.:dm(7 E/Ov'QE_N8< j|'>>u\S>gx#zt>lBoMگ>؋ҏї]ռ.SS*c۸fxmI&Cg0XHXH>hɥAAAZcpRh+% #X$?JORq~6 ^]der~~ ~apC cNŠ):TYM}9bÉ6 ENζukP A{%aPE!_9 K'2Sq+;X6-FD%s t]jZds jvbzc\!_@ ś4.ؓBS! !;g,8厰[J7tn- -e/y6w@2W?|zThQq3AZPzݥ%.ѻ?)9]wAAb8p8m  1(~)ys'V5Mҹ܍GR=Ӟor4u"&2L G@ۨ4hACkm> } ^|4D _IL_#r9Te"0 _4 r9g}txjH.7HɩeONPC•+_Q/a8;*b 8wf~:TapDYl yC2Heb&*Mʞуؼ:?Ji=U@=:٤4Fa~wPJ.H!3zy8F{5ME秲p]?ؤ&ZrKdQ \z2ޢ^8:CcxBĴr)9a0vHAYdX>Z? |IFA6Ǹtr&P#ĭQ6?~_433/\> s")#kXa; +,TɪQdEe2V-PtpqCߙMWl/ <Ȍ^e`3mpU@9Ө(;JV\ bS{R)WbmVVɚWYGP@c=+@qJaY@=Y Ŋ,)zZ(3:[ȳ~4f *T.&,Ř)5!0J9,i._9Q ŸePHJ h.hp?;cSeʉntxu__<]+byԦ,BM}ja`1=bm*Q'SՉɢ\D(Es;wzqQ|!XEOVKpGL/b7 Ol8͑O:`%2V lg%sx*Ug?xѢ?W=!(gt!vi{@)VSw`DWF&p.V0k"GZ=N1V m%:;^˯>?ލBONZ6`1' -|46%ds;q ";=O?9zvoBs2"ag(<4b,`묩&ȃ{%Y&DI4Nay>DISV^ Pz0bJa.xM[ A\.05ȏ 6AxG,; q׿ B~[D8tRY97+H)I7nAIBrarPQoiGt=q%uY%+Z-<~p,}~L5Uk<97e34!)'M$.NҶMQ[]\ unZ)>a#ĆO8|zN,T_Y3M7@Llm0l"AIGwJdWG=Qu wɸ mj t`5a{ys[õRjeXvA&YGصmMՅZb,H 8i%g\\gn0!@]C)Wx|\y!>&I^I1ѣ.uc/f0y+?I|2dcY@z|vOwڈp$GB {8cɌvದ1nJҎ_F$8d4{(nEBbB$RVV yN@S\ Q_B1:b*"m#trc"*C+%mg80Z#SZ":[&Vcm5Cio0I߶D:=TX妶9J|2I&!g))rbMϔ4;|?\nίnf nΘ]Zeb|5Qu0ôg@#D%Q~$; {Zs<1r -*xTS)<@㾵,5^O" zj ](-HDߕ+3X"b1 =uЇ76o^N?1wEkΕ˝T֦Pڴ!ڀn~pxQK0P,B=~t 6xrL\ypro#1!_U9 KdY¾.M,yC`RD*?8Fio э^:H۬Ƿu~b7ZY! ʿ3ie{:)`.J_ eVt}ʣ\5UPk|u!Lo"{D ݍ~;i"r(|6@YL~Ph^P]9 E3m-v\|28`ɶKg*Ĕi&1mUW!/\U(ϋ? RB&a!19%s _'V Skh=-iK$&>}rK˼氉v?,S89tC:M%9 (} [Vg)]b9`q;YiWY`eF51:gUǗjz|zY1&br4AQ/`mLj=8&?-,4U银ÚRiV ;MuQbx[ThGYEH8r2ҌFim~#[+%v2\[БJU$I" (v߬X op͉}͖,TL+HJ$W/؄gVuigm1l*PXʋGGii{wχdF[kZN|J@n| FkXnb6#833uMEfvZQ񣂟M|pY<$߿~h϶@ 8ΌF.3dpÞJ\w[*Ao:AAҊHReɯgXT2}A5d .ϓkErR%*U=˄?v.1ra0Oホ>W _y1_'vuD0v('7jTMi #`,Aj"65:)%hUj֎k9#II{bR=n_ ;\El$1/Yڃ 14a$*:V!)S5t-PC,{ .${4 xJt$Cb.N;.Eb3L1m9gǨFԙ:W(+ rCT^5Hۤn$w r€Nz#,vLIk?n ž|MB,\ '6 ޗQhP]B}&_)QԢ@2OJ @MaW9oR"B2px_gG6 6/cPZ|N2e~H{b4uÃ<8FQښ[㶆f *,5h#kxAqV7T2ٿЫ\*TKc\#%h0zɔ;_Eqi3Z) Xx&s#eKQm)ScxP&Zd@E0XI'gsIIF"qw~N0!-e'*.H@a4t(*Q/n% X0QGw?O>eKVrt@IyYZYuT>=xg E(=+QL- eD}cΆGRF}9C'av_~^G53|)*̈] bk8%$+bϵm: bIee5lE 76C՘"t~ҕ?8u[;?4| 6av5$z1]5C{N9=U⮦8[Ft!z+NQd.‹ʉs")'Q Q }PZyNo ? JFrJ<4,RkFZ#)3b/c#da<`#Z/GN!zeкM4>~+ޱ܃gU0FQVGbBvxCr1_LʃLת~sdxTo85Wm w7)23D5PdVMg9޴IO+S65`@bl>+D1:d"MU涮%T(pA\-ou574Uר 2sn ^:!{m+ *PIg%}:+`DVE?.oKmp9l+⫇#$؃+ho5J.d% P<8~wl` `R=z\Vp#MQp!Td#<;1J{Q}FƟŝ A4|מnm?Pz)Ҟ>7갯BbM2Fw&6<Ĭr9?φhj;륢neh?Kc,p؞4T6/|p  lphLɽ[:ec/!jnS*^m!sx\b9MPceׁWYȸܼ%i8t|.^HM r2:~׏>3, 3Mr UfRg 7t|a>*آXK#.YtI*ӕ&2?u7x{8*Toq|G{5NhbnT!M™W7  u+; ih!le*H0~mE־Ҫs^o2k u&]"Uπr'N,0-e僲{`\٠1c6܈-48`#!mX&󗔊MIu/€&h f8ۧ¨k &PbΦms,zh+#Gecoݚ46C,_~˙5-Qy5eJ{v•3\ro1;f^drt&lL&v'p8D5P` #:z= ŃA@;HTNKxe7gf=HKn›WKϾpbâf{aPS'PbDcv`H?{vMgi_c.%TD}aAs׹q{Pڬ1璭 *EFy/ۢ$ƻz{b7p+𣏕nLӯ0Yԭfr1Uuʵ,ʢ/wOAJ>I7 7;~`7(0jf\dl@a>w$[d'Omq[~ o5Glwz!Euz!ѐR+ň„FU!B.kߖ}Ķ[ݧO3Ey\_fS`S [gY#r*ЂsvaW0%2TCH+=!/!c5@:"4cb&ٞƉMJ1OݵHN*2lŔ[ nN&Dt?ߝ,v.\!61ma1i6꒘$ɧr{׹4pf~ġ@f]q&֨$- rRJm7,T'Iod"|Ы4z]t|<* kp{fYǡ)xӁRGtZ9̸~Z&b^s|O~jrĽ_ nGh aщ~"|J WVKw}өE M,:.tJriƖ="hyӞl5wYVә.Jށny7u$7'WO=SSԎ+ g4n`@1 `缚f7*GGbeV7Ή EmNك%(<"D  lZ?}u_S2f\o-)qeΔ7mĭ;qە<<k(Y|IzuŸrIʨZs]f%- cNQER%_#mxȗ6zOU2D5wL nއwB1JL'{6_p nwDΉal(ĩ+ u&ӆUo\ 2ɮR|h%k/ XPV"j.FLIK_T΂^Kb -JT3"]E} Btzp"<&K3N42 ȉ\ T1/4͵^ɏwp(R8N{BdFAD|4>o0[ uS7 0kɪ Tj^P\ՈDZ2PM+/PR yW@^_I#23UvE0 Y3[`fmd.ìJ7Q*uh}qv&\E . Wfງ~էa{\=/ uZ/Mm4.Ywnx ^z*ƂN.`1]O<r| dd[y8' _ 9'_fzNy!xkRQOW(¼0UK +]!=`RrGcrL%5cKV$[!;ɞ9o|O,NU|ȁ9WaDꚍ4TH ~9…\VC a-5~!@%=OW#5yn|/d vec3~gv3lf}pm(XĖvAkL(xRjUfRWd4JtvHWsP֒t4Zli{ӶYרёm0@+q~{e%֮#=f/:B;'kP>('ѕûҤ,lڷiDYj*}&N i@UgN%m`=Ȭ3IWWPӽ5 [.KR,>i- '}* U@uL[6P0ʳOآbj!zA84i9则_j=M}GZ|^K exd`Y}B:6L{&s, R﮵عhNl.93D}X|H׽ Dt4À*iD#m 3]oFV`< 띶so: }KV-uN)Ћ|2 [7ɃH'#USo=) y U=$tJl2q)_:_㪨KP˜ݰuVm6X|CxU=>peG9\D 54j{=ՆŲ":+ZE#J/=6Q$ti>NE-fjw} >⃠#z{)Ԙ:Q㾙L ޖ-YO}a^L1ތ{A[QZPeC&w@k ҉LQ2)x=i!?mp7Ktcf9b$ l"̺.H}Єߐ8uӟY4OY)NX!޽ l8W[@U/t$UFB|, &+۠;F'5P{B駃 Cp웥RhO)nsb/[GFRdMc̨+QC#skҔ)`,-ZLR6˪n(ޓ5 ΦHx6x()ϸeuS[⨖fn,Rԓ-_85IߟJMi|lQfVc6TP}+ՖX )].ΕEJ1ok5.eML2ᨓ lSa<*&u00P79>{nD#ȥDK(hI¤ ᠔FՋ[($tBMGM LQ xK\,Vh8͙Ȫu@~+<oΪFQ윢,Qw& 8C.| ^-L|.4wYλou6R S>X=˖'݁ҽ5ٕCrWr՝{K6&iV 7KJ_{{^#N{CFi%Jf^NnZ` *ˏ9deJ3eJiYђBĹQu-e6EژF꣙`*yV _-/e. 40W-We~SΎh9UC&^i"~pT0/L$,y7e]>#Q4SXz=Z;%ۻA7,Mv!F9HD)gX) .6HĢ}kU [Fj UZ M9C23CDVP=JGWX4s]B! ƙRQǗɷF2Tb}y=5$ ,K$yj76r}lxl_VL|sI (zi\ɏDKT>doP0Po{+P;;D]g@r׍D 3VjH2]]kN#cBNU! }IT*}9IiX}S+6a]HgA PSFlf*8O_f[;὇PlS61~eƈ )PPk'O%HE!6s6I'оFxrb >.!I4p6G5k7z;##/[]8qDN((H YlRCq13*'*N;R&6,KO^M2P 6Mި83bI9!FF(TBJ;#Ntz2 ۄOU۔+(>юxpT1dYak'gP蝿Tk3,~Õ,&@SvI+Dr$;9L*jjT3SrJ+: ,O޶hnĐ`KӠA [LiO`Hjy OS3%NsdTxզ8~/F){8|U%լNΝY_5jHvXT)6; # {|_ vaq1)&@rfO"pț2 ~D#MW|a`[T6HkgQGǽCKwUvB5S0C,^ٌ0D"B齦,LP/z\w^; J"5 2}~* 0% D_)0 H,I ʎۮF{)<N`/'Ph|M~:ALF3MDx$*_uKZ6E j(DO!t(Nx[~JZZvRS#F/(aHvPjy-@Y : .ogr>c*`lE^8 Ā!N^^KW %hz ѐzLiCzl;TxΈEؼ816E'_C* :e0MTK5rOD+N!V}∔nM` h:fI^t;c  bUcS6Trt(ƤlY*gH@@o\֗Hm> d+DtoCdf'l 2M;.{+f4S'6r4 1,@"uk %IoY!Kb'D:_=Z tH|oH M)< QA(D]m?斌D~$CBɏ`myCu{p4~ҙo2̹si+'pnMڍe`zחf`4$ _Zn荓\@j xސ8S*{ 㠺gʨЙ̚QKkX EҞghX[ jpck ^'07??)<8E[iVr Y7ל(5Bx"+$ KF0Li(AAT6 6%m ߋӞxB%?ȫ=â͗ TNu'pH# ڋIt$pXݩ"vq;$Q؄~'aLZS#‡# ]fNsJVz""oP dF -ɱL)D ,ϔX6y_0==չsPVh]ݻJŷtevZ_. ^9U fy#t#LrqUS9_pqwym+NY] t} K12K*31s^ÝW6Ѻ9ڙ*pӵ@p  v+=8[C~س&'D =? CC!T0k"Tor4!AWz|IMB ]9aQ ·ξ<؍ƧG"hJK eC^QЌ$ w\fApT Q(9$rQ>;AQ<`P."$f=5`?$Đ^njI9Q1Ak]yjo-(c h׻q~K̂S_黙},0-uZ85?r) Ia盉h"~Kx9n:TvD/Y(CDdC7*TՅ^Be~ji7uJSD6ނ:euNuq=MT݅*`mi g5w@}ALf8H1F wvӰf#L%;'K%Xlj!K§O|eOg+Q'_:񡄫N0 >7;&I-L|X(Yk -1̺}\[^#b\VXy$d￫絒C 1RmRL"T< 2*0pC\oqCf{k׸-_] ?]sQ Cr|x<.#Bܐ>bTil~McKY P j]Ʃb`>2n23/ ^8Xy ` P?"຀dkeň9.J\nnzJHЂc$W6x" I*-0 <t̔#6|ڧ?iPlf:Y avl茚+t\ܮ8J8FSq- %W51UEBث%dֲh!V6"E(xZsJ2`8 wUv톣6 㗠~׿8b.lTď!}NYA\݄$v"a!!['+jf!s4G3VZP5V`+ԍ|U`\ Lve0كzNuaZs}p|TeBGv1F|iE Cyo{vU\"|ͪP)d+sQlWdf@?51fbG$U19rM8"arδIlnuΤ(I$!PSUmY o:S3˪6XP]m0buff#rL#.'W#}4VU.LCT.Hu@7af: fŌpq.D;ĕ-T\hK1jX }M #ZɒY |TεMjШ 7%n%WcEwoP AwalAYH$NT\l }tܽP_)A]1h^>baga+ euuq`;_8p:)F SbXؙkqV$4Dr6\rSn+!?EZy~j+uפ\(҄ 1{Bs{X'9m.]lgmLS< W_vi_=QLήV*TxV-7/̳լf^sW|ft1d*gɄdkJ."䔄Oh(l܂u<#f[ qЄ` Kc#ne aZ"kxag= #IIʦ,AWʥ|W: K];'{a\}Sv#ϼ3$ODW.x!UG-.{8yǶM7DԿ[Aɂ\?9Wչ#sWCR|C9PƊ0h.&@W %eDŔFe"zսjՊ1O$#%BHiGF@{U%^'wrZG1;,_AmJMߗcmR1zovhmE0gX#>&WoS˯_f(r6 9+>5#L`XE ԦP~'pkx(]`ߜbkZz,w ր)P [e4Mbx[ߘ<Яq Pܟ4ItSDW?bÀ<~S DɒAx2UeԪ6/r_}#߉(I48@2hMH={@9S0@iLdy:C荥Ǿp}YHKVuyڇϡb]gQ 1~J;|r ߚCPsÔ ICA[z%]*hInDYO+FH_}`CHkýY#a@.rU:1;jDyuiǵ1 g*Xx2mX#|X`=D_VL {9sP;-C ߿ambbk9Wقd,;}4 8Jƺ>ʵ|"xvk]vn7[%eo-\~)&[:w`5 }h+%Θ%^F͹\ wDLZtOmPw3 $Ex-F=(4ǯε11f%/SKw]G[7(3;xfU%u:@s,^}O2`a;"P]%k{!"B9m7ާCNpnox7z`BfC%=7zM߫v_#(~~nQ w90R`~(DpPCPE"u`#U-;>EDB\?{u BJB*iGJx0`aFjTՍk{yL>V,ˤ7LPix~_, !<.cLv^;~\J$Kd2c[ MCw&].d86Iȗ~$+&\[cvq)ݦUͨ&.l=j> j \7MwܝCK9%cs_raXʕNr9 kA%4e6(Eä NAd !zf`J>U1P'MO)YWYLaa"DXEn [25ǵ6g|풟/b.!``JQ@5EGul==Qz$껵=VMĥ@Q7Zs+ qx`~TZ@H@wS>KKNJR9- 7W.+s5 0ED)uU7r]=$GOoQAIھkL7N^P?llixIxl"BWH˭,i4#L&Y%)L`]K=U2\2]72ŗ4Kόb@E ܌ShbGYTb퇤_ kmϭ~ǽGgvN 0<hbrENp 뀲/Hxf4'k!zr6Y<4!, y̩ tDs o2^. t4m'=zV! m{2_̱+~CW[1fjS 3KC S`$Gt|IM[hgk@CrWG9*'s7,kYg.Z|8kI͙0<#SQiGG R);`XPc!5,\>(_͜f6䭆<"..xe"4Cagi k.+Z!Аn&+Fpxuu5<(l[hS.jB$c/:۠G^v8RoՐE3? 5 ]Wf*#D}$G sPMXj<׵hUіj9p 5( Qg~ZT5 %OؤS|'a5DΠAYWu`fC0Lcb!|J4@LǓUv2MXlΫBdmUDr)h@L&n޴=#q 3'| z"|Bj&ޒ6 ܕ㕚2JHdO$Fy ~yf4~>AG-'9mKHjtWg+*(-@ũĖډ%] M]tcR>1A-|_O& I#Hzu@{x'vá'`\`c6,E{G@}5Aʄjp!?R\P^pgM@ Ohl̾lu~dDXΦn#(8uE+ǩɢ  ۇ:_F'Χ/lݹY\#ٻuʉ/FC$zNf t6Ҩz Rr`ޖ8.}%D^I%@+BцC"gu o'EZQ96XU1dj:&LbaQ+>5[}KEhYICIw*kZUsu6)ͽ(,XG>#F7Dza15f1'؞у5&9K)q|'BL3H)@7U!w+#^de"r3 ɿ'2HRvwAz(WSEM>{o=#Hjp#גإݲ)hJG7$F: +=4}Щ_T8q8AVЋf "0q)wk \Q%enss0xʆU; g& CHMpJ_|KVz,$~)ԥ Ad߭0}qw& ҧY٩[iCP ZЙ-?z ӾNݱӌqшsrY[KmMՕ*]vT+79^źZ_"l~ߧćCu@?WjI {_)sơżKa;5.Q͖OH@gxf2 F:vv4P>{:ثr~=Xz($ y|3hrX@$Q"kd E( ={ }s;_Wx[9)Zt#Ejn7*bhʐ >͕&K #dڗ$G=56^/)z~M 0ipUCC)Y˙#-neN1|q~ƐӶ;4MyeoE1tޥP\O4cIݏZ vrιYW'8+ɽ{y(h4W.eRCHYq\& *b2qˍpTD61bČ4Jv,1& >}8 ?[xiҪِg[#K DaV#wj(l/0|pbc̠>yLOuZmrR\H9n~fYtz*Vs[3܉9άC%f/1TUMըZ&,|jIJIm؊h - Vu'Y$>*[+ hi=x!WPUNAo\O,oC1n;ybI iOmbT0Hɼ&)cX p KlP- X. /O: @PAòT]#dԹHyi+@*{̔#R~;NCީ `iq>N{B`Y7ʺt͹v,0oQ._4_tEXX:Q.bb5-l@@a_Ѭ}2%zP{z h:gzXĮ%(Gs2(ĴF.veIݠ .6cE뗹/cuyd.Ar_"B$Rpls v)E 60.ʶl`]Zӥ3"Jk˕۬\lk)n1RB5Wڣ).ؓ)H.MO> v3`Y Ż + &o{?ۀRlVjC/77KqIVx*\ gJ9/0"h`^dz<խ.dDm(ל=~pg*ZKd8iL\Td%5޺҅(0ȉGH5c{SL.lg~XK蓔nXoЭMOF,cb?nڑ{.Ä ePnnSkғҟ9 PyA\sVu>zܤ;#9sxߣn ]EAߐQt/RS//v Y_]yeG7u=, !eeTh,j94F \!%b[gY)e;=w]%@ȒӖ$ٚd[Dxm,&N225X5q -4 s,5ѹ؜mOyvR@0~!,@|rtPD :5,6M޿Wźc_JҮ`'GvT:[|e9f-o:R۴o0{5F]qf͕ a..Fu fHrz7=G;׳(nV."̪+!KLLyK,3oӘ íavq>1ii&zǍЅ:q 2H2+XA2_#i>R+qۻb bQVHD~$ML^;2@d>D|g[eD;g`'~t3KNga!b% R8PW*[Cb&Hli*Rn?:?3uu}CʈzsbͲC)OvDCbTOT[R/ z$Ӳ=}apvmA؈OsT0cӭ,:`atxx+H$Շ3 f0T+##VT`P0-A fjocbrX`yZJWՏ},A7!*bu""Ba=eRߘN✥0Tދ>a qh5b"w1xؓ렞YC}z:h6cWGO ]qOI?ӳ#pүS^z'ca_SYYe⻙~9q!iF#oV FݓPɵ߅ e8'0aT ܍C>y=`tӷYAYT#Oɜā8;"{<(}"7B$ R rS/tD~ Z5{k<>0<j(6(~u#9U|(i[^ 勺 t\%]C K#+ru ݕxS78(nlNs"F7I2ɳ8biO]hViC@ߗ?t\ň4~jO[=nI(Sr5 kP6 GJ[e5[ DSSe|p%M.=/őCb僆]PB]yh߽xf=+wο^t6-)QQagphWhuR>x)zzO]*Jj1ȒE IvWV!?V8,=S"MxSf]J%ac#.||z,={P q٬ZX@ѽl6ŽuoX94n5ms(dHA͂DE~#8={[S 9[(\2 ǩE(k Ts l*} vִ %]٦>t/cXI>MS Uܤ.O)O8t`8d6Am9H|P(8fa;|dWLFM;h*=MF"E瞜B`% cyBU+#X1JC2(HWj)Ȑn$HakDnvI ]5{~j+3'M}"tcێn.:=_9,*~dAUӿMy벤e P/ۏm;"r[=A \C7[oN Y~:U2{mf(ڹ-=],`L-RI;7l|g2t\'h:Dywp.;aE!k/УhE(*eqBPDDSϛxQ(/`l[44eEtmP901m؉ u޻]}K붾,\Mf+nu!=A*I,7p/D=YW&u'ldrț_tI^`? >o[TSռ>5 2tgDPbܑݬR̚vM! 2ڟNHIv0V e&A dZ5ީQ i;+A(UA v;+Yu;#QpWeAGwBSHeSK;%2Y2@̸L9 꽿Ǻ=O F.Gh:b~?tNjF} cQQLlF\DWdCWL__wE,CS |L᫏f/6'#Ty^~#B |&PΩ"opd #1>fL+i:Z–=9Cf Coq3!{# `7hDh}Uc˖Kkn=rQ_4r9ZyMbKIj>ȩ&478 ,F Wq( Bo7#}q%‰goKG(tť:G[$o*q # }UTTk,ku6ԈKE@S>J3N(YB*)e,CC$81$tƨbIQܤP t B/[16,l=VNGa ? ϻCrpڲƻn[}12qU'9*V?bS+0Y!LJR,r]!K{ M{adk[ 3TR( ="P` adm9C9fvq%0$7Ҷ 5  50Z?6NX-.bt/Xo[VgÓ<RCwxdJ5X-c}B1s0pydi&{r=SEIOo*ؽ5easWphLDrf& [ٝW2$vӶG膃Qf-iVIP#kH< N_057i뀚OV&CQD-â7ޖ 8;ؚͣmh=_>tBF]K c*I0֢~<"ۄ3_iEt67Tԅxw*cW/`ed:ؚ9Ⱦg6QҺ̫Ua mv=vjl˄42Q9ʝ ǭc3jmY"׌?!1KcPqos^S}F+mCƪcLdj¯.#ԣ/<﷤9:6!k]A)QёBV|q[BfwI3Q8<;x06+wi؀\A\\)FZY$ +[& /2*$}s#L\% PeRh`8Ayشym W+l IMc} 1jv ;?/-3{g'S.50JQwLB2"Y3QW xb%|ՏDP J}$O~u2^d2qV@(#a|\;} 7*ֻimTD]||hdmhpÆO9yc~|8@$c9:aYS_=0;UT,7ˢQν bt0j /^zщ\aSY?^ +ޞE!.Kڭ8s(8S9{5Ȏl/TWՅYT768&F,Y'I|gښDr#rkv)+wYrpRo:Ļ~]a_?uWe5TaSmE)~"VY?a?}Y#rd-:{Sp+de(Y~/M0ް>eV)E;ԀqR J{9ێ޾Fqs;*a'm#E7d#;m:vy Ϗ"õh u'&OڛCS:[med;_:?z Sg,Cjnڵ4\sz#m JuyhXUňH~Rw,dJˠuNT4e}"̀7nX?T,|,*n14u&*W*0| l%O[ǯp#4 2yGg辖aBAQd Z`)'T uGwe2xP R4;ٸMÖO}赭Q?Niʹݝ}氒=jQA\}t{*nړ WC˂1'[cLs|v^ (gMpWq=yΙߖKc2FS<ٌngIPj E4 pewS{~(ϣ濮HJ`.D?DUiSDF0nqjBV\r}3(k| O-7ȍ5.\WSp{}v <"7Y^Хw_Eʍ~jFQQ$τ"*u@BwXKp;(@ Hۚr,]r(Cqt:"x,c9O/AWG5 ˅,w^"9*lj N5KPLlZ] o76dx(&n^b+?0Qݘ;yx%cz%pG[wv8tn&\uC~̪Xo\2DsS)g(Thsz\ tTsI@r1HI9-D>3&w786=i918)%]6sWTWxW Mh(@bٹQtiYU뒚E7y.h!>C*;Qȫڧh\V7"CB~5'nO?El'nlނ!Al]9/UX&:$~}.>?M3sv`utXxZ>DG[ .ѥ,n7%?J^nvvTk6J\jf]y[uյk?acn޺8nCiH7$apR9L̜ڪOVց5vy;ӒRm֢n"eF&=^[f6Z: 5gG !ChuA n%4}]꥽-, 3h_{J[)xu"Cu!A9A}*+CKsϯ [В+0Gk:~PQv;+nI&dSJw W}鈕t5=; ;Y%TZ3'ˀIC0MIrg# ?I?k bV$^C648GZ aY-#*^2͟ %n?S=GA, c8e يQ!TIt")BGNMEXouNݿ}mE/u!N M3v %A9l'r&P`{6 * ;;}NϠv,$YLivNrpqU v7RS\& Jn9?ђ(x)1x]Ӝ`"w?BN' tyY?'ua'R-k"(p\j "#IŽKJu5K5Xb)6z;;ՇU55՘h|*|ʆŠOr lI MVm_7FcLDD~3Zb )ZXb G摔\a~L%{"uT@m,"ES_X/q A1!Ȩ5R[[Ov'jح;^ꇜ_7bܵ ~=b8c]Lݡ4o e{#3ۏw7vT/ӽzFvIы迣M>УN!@i@CݤInI?0(0C`[`黹D[䱗‡V oA:ËnFǫͤ01zG^|#9qQ j!Ю1YEub;u_*5wCmRŌ۔<>V"SZG$1L߂'AQBb$`#hB:=GxXv}ED*Dv仒 H-;ط~/:[?83ּѤqagZ-%0FO_\z&ťYm$3 U{JH7$SYhW%W!Vh)&ɱ0+b>!9F3iŸn_!@`2͇ࡷPv+_w\#/{iZyטU,̽VU%8 oBl"kڮaɷW DtS7hNpLPG^x_>SR5xD˵b=-Չis*&%_Eߏ[#6՟`7238S S!˃ZvtP0 t,$F<[/'Y=rW<-{^hNa\*,32ٱWBɛDdPDg!V{/&箬5 *zcTo=(dr8\ZW"#@! KR+wIreSYI|dEnex1zW\%–Pf *(WpP Ըo8s( 5gwgt"f,T3#/+MEh/8ʎ Cr"'BbEbѡB>MZю< BO*Y%8dӞo`|t, u  K}Єz`oΎpE |+ߺ/8o)&t{($y \L8˅n=ߚk]@'K dtB f {">Jrt; 7ԟhN,k$c=%וA$D־[-u^O0^ 7dT!t7@á:[:࠳E+7+*.NoG7Ghˎ .V3Dǎ!lT`֒8x׹jq?L;fl z{m5t?FmvuS * BWs΀+ⴏ$.' V)@|ٗ"5NU v@qkXjQmvf蠣|QZ$zl!T?K;a[;W4Ҳ0|ꄈӊ@nwM~_wiQ!)s UdiL6Q|+"BtcT. ||o1͢F {W2wh(SN.6//~ҐbeC9a ti(9h fJHN f U?t=_Tɞ Ltypw 0foN3-jqhJK%sXS*DOHKĉ`)z@(#ܴE-+FvMR'[F@χBxʝh10-Vh,&Z oVX?^ռǔmSV$`#Q,|d>iIJl703vҊ7T0ߌ踒9}&? ɸ j/*ܬ'vmg(I U&e`9$^{޿swGFM& )(ZGlyuhM)VZǚ8K]0c +w[XbAC}3D×QdH0_yB/+aUC[ȴ0s1a?Ժ}>xq8)dۯq򷉭P&k\v (mQ oc7l /Jc8nGہBtUUߊI#6a Rpp^qЏ%~T7 Df,ڢU[Ʀ'wɾsk ``;_R "5V)Ë SUû47LBOuZhT:s-Q0~0d#aL$sMG !ئ ?(NH9Ŏ#FO,I>-cR[ΫH1. ^m+h~S^HuVDLD;TЅb⒭!ZR@ԟ#ߵwjEh$/: }?jg;zGjHwz5漻LQۜ 7_nyXM4b~YBGҮ$*\ N5)B$eр_۸4D<G5$!0&=8|f"pdp 4֢G8Z/i/uYh Awlȥd59̺RM+t=w b6zꕗQvp|忑O/EMpET%be;(.>WMщ_ @;rir;)F6ޫ4ʾnd$'rk8]T7Ơ?CGF 3"@amB~*52Y fU Kq֝ 4_62SC$zG:tV\VRZ-R~AԼ=#x)SKIUw藲ߘE D}6{hA=im2!1F?mOq2)< -- Z< s#IuM2!0xhvH_.k\1Z@ԍc`$.@2]'@=E}EĻz4^p<7>OA!#>`+#Cao`CyEtM@ZyNaOˆmt^K0Șu}N%T l]^7uD)At,Q(#JUhY%.syڸߝ݊4,:UϤ_#:uA8esC?|{9+Ԓ}[ brG 96@01 bq?#0keno $ Ay!ZV ^_a&IK/c @B)1=K͍dBVc]ʎ8 :\R WჷhbОZ6Mv-w;+,ǀ"#\ Y .fkf^ R5V)jy 1[ͻa;o?OrtEӇ+)Kk<~kY,KߑG lU,]-JhWd2kew"~oNrWsjHz09TD{ z {8Yl+i K.98J.rP6;%Ei*:?=Ls](ujt?E=!MUTcOz.B $'ji6 yu>.{8EÖH^ѫl i8HDŋy&`Kr/\>WGkK=|Rq'֒X:g X %@5i8Gl!kco㌆D2fx0 *e b'h}?^`qϴ+%вFLf/U5cecC m|婇3"W.gif}`uLӯLRa)\ cE=^ N #RփO65Ǚ.s0*dʹ.?֮$c ~,ӧ(:zކ<;jfL9:{>E3u@'+%ĒY^c`m4rNXQj%fmH@qJq^s]w}8Հgtmfl2΃~8`1j6QߛU({O:hي:;em >/`}X;9Wjbt ֐[g z&H|)8 tvt_X kg6an|^}Lp`cp)lAKYCrvش`qB Sb>$:IZaÇݘR?’J ٌ8}\KЫ axZ$qD6fy+JzkgDlgT)Qw{v_ oXS>Zij9HpLvf eEфX_rtq`N^'W8uKw9*H<ڐNUuY8h<\.ϛ+|&Lt)؈NP,: * љiyZbY en937wߟ)}d#UN| U % )ϳ,҃e lwva-C zi9Ug%6Bq.y )," K[Cs5gМ|ZDMn:Z!)Q6:#@z7|d%@PHp}ݫF>W=hUѷ\c {(71!#pQbamى0x?pMv-)[c`Ro<ҭ8oKTg|1xJRhhmd N|CL^F 3 39<ZVT"dMYD\tPMs~˨5F_ 'IP;T,!?$)7rdp ,|1՗ _6 sa9ˀ<$e`qmSrf1%Y7r󡀃όp<:Hܞ waA؃225:C=&'֦y&\qW]y`6bY`Q= 1|ͲxZCC$v"[Ze!v8 znK&"T| K31h7Q;RU+a gS`ڗ(+hAyțN0Ji`Ĵs3R;٫O^P˷ X,iQf|{&J/RNOr#l1jfsa FOC1UJ\X]kzkȂ8a' ^uWT_<<Qk%x-?]fV:PO!BZ6!z|xĊk`y9,qkS嬸 @|"t(K./`$dSȡlc$٪Ry1,)y\gAywcU[fRTj@3Ψc[1p.hȱh|3@rtcJ8(HAi&>x@og6%FųejfiC#ezE xحtT%-q8kG6O a] M,\2%_h8Mo1WՏCQOŏ5s'W/D sdV eM$}\ C/2~ؖ!GhrzRX#| r"Ȼ+9H\Jc=Xmf~;h~4R^TkZ.%6A.t$qQYD G1ٍӻs&ǁS snU }(kϲv{T!4[`EW)D5 ^&|}Q\nLJZǟbd2"cJC.9'tc$\{5$c!J"$_b5;3kUQW5e6lB=fuVaD{z-\.~rA7+ǟ9]-b( [ɀ:Lf!M[Бu 9}eC|o$>)qؔՁGp1h ‡z\㳚 C!͞ ;ry*dض]mS>bE L@g;qcݔ 0q׫5VIh8&=zu/ ۯ9#10J҈BhC8NPXzP& (x]Ԡ}b"k'E{n> F 5+у 9C>`lBIvYʠҟ [ %(=OLGf*7EݘHA߭.k8(6i?d=9f$Ktq CF (ݏMn^ PH5xA--&mהwVa%b|a<\KDh&1ֽ*'=5{*O8I:ndEj]8 \zF2xB:+ IoY劊t'2Z%xhXX!Ϯ$#`4|HoXniccN{+wEЁ'J34C=-?o^ voޜ/Kt^WKY(XBZ~)κ8.a 8>@3q‚nP-4oJ*~#E4zXн*SB0m #aaX'!Vqx\zI'4OVZF^\3MIwY~+N_.$LEy,ZO;-AaZD@wghVؖ1kN@v`ݻDmPXSы!Sy yrP(@萺F:_*b05m\62W۵lk,1+ٹWt 3U3?l']u )Ȟ}?¨Iq 3Sу"aD5"kn3=s`(gY}m%;3Eܔ/[I!ӊBXzJa@[E c4չltsȦ֍m{xsIX`;OncA02X2`pakl tL$8o9c,5=B40"~.90Kʃ;n92ƇF arr LGA|zlhB Dp{K-?*3myʼ=W?4m0ZBBBR4r_#(:B$EnRŠHs镩 򳏔~/~n+pB2Uǽ>ϧ=1?NQi켁BLeF8Rzv Q]+sF@/~"/= qQh3x*-͙I҉ (5x?PP<\l@\I([)kLty Pj$?GDTëkz̯L}lM7^ul3VK !1p7Nfa)RR@ sy; vz:XTCnn)o/-V\ak :,}4 c Ρև@22N+4x/ӣ:2ȯbRlG%mj$z7|nKwuuX :k;2d}!c̺E z+]a=7$#=J.j2P'sgx5oJP;̺)g>$_+ TY:]`f)ϲAgVPt4^(;d9yژ/A޾rSzc5m֤ɾ姲{o}? ~L}"; r\T&>؄JNjx{Q ɗM\0:aC] wjs7|]+~=,FWUW8E8(0@l4ᴔ㶉D7iPGڠv@8p?/C?("g<1։iHl<=&!Ou:K!i"H9uexA;YklN6#/ڝ9BLM? YC$Y!д'GnTFSun I~<HͣQ--ˍ)XXe^VM #6 &$0i?묯g^ 8Fu  *[ i~ Y"3AN;}RZ~ϾmՐPqJ-4% LI`5eR;+K wKmIUP9lb.]~PI9w)6&dAۼg95EjQ_AT J6Xail*nRg+(]בaq>{Dޠ&Wbxʩ҉*6þ NĻZ2$r-a4IH-#yzeڷT~TiЛˑ K};`RƘIV-> Th6i0 淓n HHFHFJBpR'֊紝"]ˉ3XL0sQ/Sȗ΃;2"cuqM&2\d +|VNclGu+ߜq (cJXU"F5(jmb{Q}LLEUXݿIhn׌h{ ƌ UumT]q3UupMX̡,uXڵ"2$%EۦTOSϙ$%LH.NϽڙ8${!Jf 2^& Bqv|j"OT2BZtpI_SFǜ O`y@D0(*z8ctj l3Ze'hؼHT'\6:[1rb OVA{2)f6ׁ/v5^de(n'G#؉ZI튗(m[i309WTƌLP!EL}0K8dm]B:?\^u7A.ȌYh4(IRUYzDž>a4a VRhX}R؍T#:*фH1V-oj#nԳclvV^U`<7?DB>+@ԗl@#%;m=-ps:(j@*[N ZbKq_VL7^U}ylU;+0w?+tmQ(%^_bU4)6=u/:VJ.;1=zHJa=;”eE/)Ѱm#֪',Jqh/~6Jq8z0SE=vs$e *'F mpB c3qKZ(%盰`֌qS5&}ѩ2w`(3JZѭtPeH$cPPKų"HV+ u~HNr1 1K!9@m`k_RIٖ8W{WQcFaN\A7MAx2|_Έ5_qE7lX^\1Hxsu+gYw~s5;;W⛾xL\ jLxv\uѧ"Q8?v37>ZNo|, O tCt1G[BGq@JvCDM6G̣5GjU_="!=qn .z`Ksznbɀ狏P40_I`$*iGE^6~x)"@T?gz1{2^;AQ1+ &kx6"K""N/JRVY W-cN8،(aȒS7.ªBWOrR>:{`@o~fw?/cH̿GwF9 !;i*r]f"K!8әJ%b)_<2>Fv)笙-]#?+~\$p~5)Hfd{ȗ 箜ٹmI5`Z^/?JWY#ŊYLT~\v$yLئ}AĬ"WFDRИ,EH9Z3 j!OA7 =gA5暼#De? z|iV&i`Bn_o! Z;i?~Uì۴a.2mI( t>4V<Aͳ.&c1*uӗ767:#nGyiv^>Qg=ž{=aAF(`,p [}?F@ 4(~kt/֥yQ$=WYʵ uo:D}A0&{YE]0˝ŒȈ6r%_${QCAE q]BV ? em:Ҁ/Rh |pǐ49|/cvJz=~8= L09 `wȦeq4ƻU˟ѸY:4}Ց~ FJ/fZHBRm#ǘm0#kKtdG/_iɻ$fG[hӇr884Qi(ў3/"9Dz?U+JNAcњբ*bk 竔|'}̽4dX>'YɯЉcrk;[lA$-^@czifJSI3h8$Hxà[x;ϋhء= %dzpR~ڱUtPYs^U?|78'tfE4`ґYux5ܓӼ.f},3~&퀃>Z%Qر`ΫAIV(Ӿ샍XC*= Iʼ KS9 @jV!Җq*/Mb[1y_|5oJDz8l?I~A1)7FLJM;QRJ=Wܗx@jTz٦5ig Bhw` HEsttot6Цc;|W;g_8Jhc)0 ^osԀN xAttK,6e%nϘDJd-IsoW#X c` F/1m- gBuy=;ԛ4yA Mzpsa|@5ԒBdJ\f((;akY\a 2kI2G\z =:^BK2'h*=;V!pwm7g ˗CTtЩk t,0zς0V0-t':0!̯$7q8Ml7{-#!#hZg_y<}!"We)YCNjj4u13u n`y r6Oujf)\ⷘIyEמ7J~_SN*&Ճ>*%twFD['t~AsHC%o& ӾȆJTGSkO"i$(@4'L܃wC0z9qy?8XxMkΑsg#ѡvvNn]\h~mH28l\2hl_I].0Bꀱ%Qj88OӢ [x\6ؑ: &%a SBw4d}Ea6dD v<ʼngԚRs t_zXof\;.J'dR*\B;G>:~k^f"QzBBԿ"XbfGN~N>BEr|J g!L|wVrG*m*FOj,[m6šfպfe8meax74z--%+ivע =YĚ7ltTMo@ G'II TbPÉi+2Ib>LKUD{6.C^qZB̗BPg~xVϧ%k6 \YB~}l!kRH"peOPA)Ǘ Dbt5W٫`?\BOm^Y!< G=P%!p0SB{<hL1D ҹ8jAՇهdd Q@|J=.Mh]t{%\4:硓!^[% w `.#8 .Ne ]oǩ\^-s37a6U>ј6(ڛڧgGoAy00qqV q|Ioհ={%!OǞL !/I[($>%Uʩ|+QP fVؗ`i|p/7 4Vn˜V@ڤ6bOw,w1:P6< aSТSLjC~_jΠ`Cv\ 15ezaWz#Q(|+&~ӗ5Y;,[1eqCɌhO[dH*Z :v(rohS / Q֜ X&+P*j{paa`X|՟Hmz\!hl9_S)Oο^L 4k!K^;$vp|Ё|KhRx A7ژOɥ}W-ws1;,Ml9 ZC@Mhut {x_/zgbG,r\KΖ8B ?э_uK&@ХgOnRcNoZ4Չ YھR@2NCp9!M/i!Ʋ? )W8mi%`mf(b8X^~ "Hy/&*Y6Mz2}LvNA+Ƽ8vdtL3\uqYDsFNCZB=c Yj` kńAgI˩ټrD'߶r;86EBP刡mu4KF_!>Oî/9$\Y$NBXr98YV*?$f ϺyksՊ٘7KKd.8Y!tNp [2;]b ]+;|d N]1Ybؘ`qݎ/TO@.( oķgs&XV̯ |XJ=K />;θY֪kFQ-!̺Ҥ(m Rqإvdt|dW,l\…}=D-e(>q"9!C Z}X2x݇Qvs.Z8*濆lJp~GCN^c<;c`w(+@YкGPn-p Vl ,U\HÞړy2$p#!NJPx)R#qp%+: `*L/E0k9N|c??2M*P<r0L=ğYSkE?EOk P+4;VוMi{#|xcp52VvXg}Ic\ g;v" _{x ߬p8ub[=obSXkp`6N+h?'I;72j1xl&o:x znBnNb43[3^#CCV*T\2)<ڪX0) ڌ]+|"dq^yvguY@Ȕ4fe̲11(S:n) 󾿜- dҩ@qjN%f[hQg>It꟒R, Ơ0JzeSؐ9b_$>G.! JC ŋ ׹aH])d]nVkpkYS'jzΙ ݸ9rG(܊)r-qi!U*Win)M#9v˂i\B1_hySZ\Bfw ָ5>y:sPJN"lxƨls`wB?iʇsȕ`÷7p#`)q4aKi-Y2# }!bz/\p?LEک"-O r$[چ*l1=y"tfpZ3fG bl;\ Λ-48T|D/)?jK YIF zB{2=# >&js^E@At`.s*g&Ԗ蔯4 >>NT"Lf^5͢ˆBz,7fh bc V;v)m>f_m  0W" 1DH3Q? 7Wu jH賓j#cLalF|-XϏvFSJ;GeLCAf{mqN\CBD i%mq.2;b6C2q?Hl` 3G[uvNgW)m)v +0Kx(%}WUߢ#gRu5Nd#r)Iphqv>p\EF=0_Ȯ vxOPrMYC/hhv 8;#FSIA]珨?uz! jD{SL8d>RU3K;GH~j.}f aP͖Es ϒ sWSDn8H4X1Pp;Gz 놎!$oD^ڮb -{/i#-(k3t9S7Q׸ g+`wF`!yЖ{zYȣΠ3ibW?|^"va;Ȁ3:T3ND}&RQM-B{1u qOAzaUENnC|7|)#<@1O{'4o4kN F"je1e" bkǴX#V؋셃EN%f±)uYÌ߈kLgт_D_ͧ^B`Hɭ:{B*c.g%@gD_cuPi0IF\*<.Xam%Y G\#aU;{;'/%L~ً<%d8:= Kڍz4} 1qSSպ3(IURhZjC"aOqs+Iw E[ԉ0/,}J66 pK!0n+%GK;7ܵnC=xɟ aߛa&}liƏy8}B K}(}5. +#.o>댠 DOu7rK7OnsJX}NR'!'l/i% st2t f:W3%GG((MiR .߱nmgMPq.H`a^X/F=%Ev]S@hÄY%gŪR6QlFµ;l,x.h*2Z[#*S??4RΫ$2dS5`] ̦M90֐<-6O;3Mx uܽ|P+J TGGzl+ɍ"/_& cډn*l |`u݃I囓We02W4'ϓLḥW}'=v; a5n; ҍ 1DCOFLE%}.I6D>M,mt &+Roo.K-f$%o2{C?u qqi4COޟ2+sp,OM;mr3I6jCBɆSQH K~H0vJihd)\i%Q !IJTx3'b-E $!/īuB R:20Ĝ"AqcH6t>!Gȉ{U,b j *()[8#.Lo%q8? 3W)BcvrF);{(A;N%peq*~=GT8)~F551[w16IU\!I/#2l-Լˈ> sI#4jpPRe^f7HQ8H}'n~k%k1#{wskП^ZETHGM=dٴ"YN8MCqx_{## Jn}=R=ˌ:<P/1Si/3@NzkJU"$Q*ÅHk4[Z(SicRWzO u5_ԹK$‡7&X{4rrl_-FXtb6JUwh"<b y{+b ^{zpCI*)iﺗ ]gTujh ;O~ bv@2jvbif>*_G"ĎR N"CsYA{3DяFQR =O ҁEP;,!d #oԈ?"OUud3D~(%-r:@-dmuIs53OZheafPXx6ZtF_WLuU2E_nIFlE3߼/Y*u\QQ)(^LZۇk`:fmULAXsDèڂ=&ʮ!~4ą\5?G7'M382X~oyo$OD}N0SܤԴ's-f׵8<>x(x|+ȑQ 'gS ,򌕷szųg"\dpÕBu?/Ba!fڜ.UժIbyI4`G[Ҳ0#aP{>I?"`ZVb8ݎLod;l}5Nֆ8hy f5ܯIn ۈnٌ;Y{3HBG= egd@46~TV9 ־z'n(e_UBͧA|wY4PM%xf0}:[ 2*eQA=Jz`&4N*)cEi-1c]G'ZEY0i]ETs"#s0Z"} }vu8Dmzz;\庱+4=iQ _,XZ[MP74îV$HY/4Ёr[CIJicb|)?$I6`BDG/d%qV$MɅT衒{ =(–QXw{ o Pz_NjI&lǷbMG1K|s|/!ų Qh"z-﴾6l`_~wT%Fd`@0!إЈ!7ߐt2& jnU#I-˚-B #=NgsNlD'0Ϳ˙W\ ӫR$:-ldpwrػEpU2B!Hk8bb .L`Smڻ W7C )iI׃] 616@N),r1:,rV=ʴ/Ze|e6QNya'hC:̹cE~! dpZC)Bx,`ZA u~d$nPʹ:јGX' ̀T@`_=g{ĮPp|gnw`R801%ؾ仂ȑü4\µ "bG(g&h7iT~{*iݝ+ъ:9Ѡ)ZqEYK-jbSMkI~X|fԴXo"D} l f ֽԐOVp}<4k"hJbOOG6yl%rSⲻLƲ~…89>K+eYCs[|@gKL*9 te *,:n0rc5u30B'D/+mv:Gu@ .:s#LN;;Qi qS I$aM$Njc{*iY|1QQ]l%{a­Nǜ!E's8Tr/Y` $NSX7Xu㜟t!MR vHo<1+ vAĐMzc$.%-HɤJahXXHd7OɀXA|Be|a5'W'Cu!Q8J*ڌ=6[E;H!]pRY.[80цI~>WyOԸ4u*=֝vL)&%?~'HDllZَB--p!OBJ ~+ VrxM_ Hp(uj#tO/:GD4x3zt:sBWlOu26m|ȝ,ˬ(ȶ&lxP1U'Zc \̮i(XnFN%>!K'@S d_>ȱj;Kh B21y=vW=3FqeSh:Gv"q#~kTOfLՒOp{eB!/xL2Ѯĺ[S%Tws?(ݛ4>j5sC˅DTr:*yn e`u.ϚD郘`%pBˊ»?~\(eU9#I9U}a˼tm6wU6f=eQm/*D:= ħ4#kǨPq Ϫ: ;Txlm4eOVA1 :dnp%K~bYXu9>b@2֍ DNqT.U(XzO{ISƉFl?U$"Yz=C4VG f`ءN. baZI5 z aK]l$?V@Pk\nØ,^B8fMurdeWq+b}-_ċcH|(+g/j"2њY!0T!uqdBWy5[6QzhniIH%[Xqhj顼;럽9"%VOU7 (Ჩ6Y~11RaQ\1nh2ĉOJ -J MBmt.SDa4܍^0IERL`C$vtghl44Ihq|?˂(><պ1T(rF?U8-?"nYAN/Xժ8w#7~O-:myNucک7( 1R`IB y}0D Li88S e6xRTX Xj-мfC/M_TQ`Xu˝,?:w/LE7T!fb( YYJ:XTg7O.djՄcѥĚ)NC=u()%wc8`z I_u,\ E#"SU>R1>2Nxq'A_@g]M^ew#aQ,)o^%J=IY R]?uիSK UX#48)dx27#w+>`; O*J3EEpAQ+‘4 $=nr§OÇ uP5&j &S#żeϙǕr8@ЗTX(IEhTDyWǮP >L} +xYf*%^Gb`M=T^K%'WfA*gǸvR#n4DC8Ai5V0$e^?Miq<: wFye޷nDCH~|pE2ΕC>7] 24%Av=9"ifs|&RzJ+]WrNNgXaDiyaZ1 'SR?H7f(q 靑ʼn.)!WLN=Ɣ};)d<ب.:@~(;-q_x6Xõy{TepwJ$D(6w!oOþ}䄳ۆ+^uxo~Uh%tbwV* b|lRfS%ea'7xӉ+g 2 2~cZPMfoS*l7cP:mY zҥ:5UHr]{xKmf*:hKdP-P "/D1?AΟ۰13c3zS%ջu'3<{VWdդs%OGZ"٥~/i<چf]HXK$ZˁX x|@/tz쑮VK]F cx]9YҖ^fqqa ,ٔݶ0K%N 2-"cc6a~]$HA$k,ya&&a=AhVHt(ï7/7O嵹^o*[:OV^,8ea[ThL!d*ׯc+^<5W4[ώλSEK_.Fͅl?AgrH1< =n=$]yn0 !$Q#_Fwt@ߟ&MGd7vJ38oIiWl8hUa@VxAಳqv=+.5ibaR @sGq܏ *ADǣۜ/kxy}jj]#9Tg]+Hj!xhhIxKnSYdfxYa=1t+{)Qp+nsLNPM*J!QO苈?Q_#W4t}1v0ڠWT[åGXxrLvOvD# "6~.prf=i*a4iڐaYvxl@"7{ce X%- [)j z:Av z&ZM)^_7_qUaиW8fC^:h`u eMqvu9/ L}D]Vk@{S.~t.>,(7=g;EDxFBxq2 h ȩ,vݒ!I6tu93~+:kb1䆁U ~  ȟV+ϷД;(ڎH&gw FzXfgRz}$刹pvqD+nntR{sq IS{8Ay٨G}-:J7 d}k'e=7m~ra,~ ]EB5}#\N>"}˗prt#/j ைOiy)_"iYX8]Lc ߁ ]l1hg]gB6 uϙZmoЌ Gu74.`!G 7YqȻ n@%x&hf,!<43ujkL :ERx*;wL>Z2呂 6X{1Nr&M-B,6K،LAӀz"DE~rB`5ASB7 <6.^jɍ[s؇Inѣ4O-Yڐ)#rmJcjcfe--ZV ֳ5Hv24#j=EvA5k=wX։xJ @9#[F9"0}~6-GN۰+C-1/h2ثlM(:2:: qBWҝUg blG;}%NYAg.! 6`yRW^ ':_a]A\by_LOe΃~P+Dsnx^u9G;cjKv>DVybAD6 6O83m_h1;Rag)skb<d`33vaf1Y!(U&&ol)"*nr\xjIcd:A;xoHRrʦ1r{_p0JCOӃ!uX]-Zy[j-pfiGHMEf] `{gcƾbuiڕt4"MdWZk֐ߕwb " xNdOFt#U:0| ;rZGs@D跡0H& .ԗOm)%]ދHUGiiG> خl ߸}0\uIԃ*e#(Er'>j]|Թ XؑWJ4EU Pĺx]] 1;+XRTN=] >sv|5(@z&{E{>|Vn HZYAGvB*x!QH~Dxbx.;Wc!]:;o͛;{GQ4Oh/^v> G9ȞdJMgTڷ (oHW)$vgiBfCTlz]="À`!5Ph?/0Y;oks`IlFF=ԡGĎݡjZ#y#X%HO;brL4pU]*1[$J鷢C vLmZת˒ u NJ,o+8,Ms҃.$A[K;Mm*"w~kJ^}]2i'_[  FQp&:sK&T@ʚ;Tݦл;G$ݜ2KVQabw_2U?;|AfK F ;; r%@)/qn8xQ)P@&n͌E_Dל"0X]nRcP[)ur`;,^ǿ%dxRRuji4; Hb*ԂIUAÛGk|_ ӭ3~Z,1> \i ҳXH>чh! 0s5(cx--l!J`#Qwķ .F8z4/9Xd<"QBi}:G&ɸsE%y\nHߵz?algb"ݫg'Ei~bF̫g!`Sue qgQC3t+bhצּ#ezJ.;(jSчb$4Q>'&Cj4  0|(d=p]"51*v>-5sOVI#ǿY~f W4SQ7%tRrr(m(]@l1+\”мku.;ih!zrtHnC-nucvt]/o]%'҅eP='kSs/Rbj'o۹yƔ%]ʀ6N{A@KX2!dkPZCGg7 NrJ?ajbz>!|T\m4'2ŹE*\<#pdw>e]IQ~"k$!= %]|pl`Y@;M9Oyp:FPZ}<1KyќȨZzxy'3htKBNQ8J)^ K8:SueL6:;Cz J7hۘ!kCH\[;>mW;xdA\#GU̩rnFpaЀ , ּH$ޯr,cd7 &+beMk_o ႒q@[*JA<>7.i 7Ɩq,>J} ͑<58pWJKE&~{ EirwcЯ\:k+'yAT4\a c7Jxi-mdmH)N=ޖ~(qx( “{%շeTuGxun5 DWn0 o}2%C"eF$ްt#:_<%>Q!Ӿ..H.a2au |. :^Q ]mS,k8| `%m-\\imo&%Eor`0F+t[ʱPH,Z7ry(n+35- f#`k$<ѶG;ʣb^eU䷔m {i WYX!g;α57: {K72l4]b(2,]Op;pAĩK8 ya,q 9^JCmy a]/rr]P\Z:OۥE(+gCɰm6[N򨿧o thV Q{Fx]P#6VN4оZ,u G-:XkDcm)4$Y(ްv<,rk;}Q*-M ܷ )c/"om.nu<:٧$W|{DO = @ϋ%E (vCbؖn[?dd-WM¤0Xi+0t"ȿ (Jzͱ8Q^A}+阊UcvYٌgZ5&oʴ!^4̍$S2( ˰R, cati)U-]/ԼYf+s3VvC 'zhJX$!`eSuu#Ѷ8lJ*_\,՚Ec:.i@I9]J^Ȯz -w#YR0tqz65ܬɆ/1" p^A|~&dj.o&)uLZ,Abآ/vlD,^ A/s:KlRu V !QnuK*#\|% Qeۈ'e(AGٲQj;ʃȘo>A)[RވrKڬ'pqG{@b.uPUDM5,>| B9Aj;d{iy|N{bFMG/w*eHwi CeBX%ZCIݑWe>/ǽZaSP_@' Ebf *~'}C{ JvT`/+BY0|Szxsdô}aK[a^je#)J\Ӎ.%"{rBrQ΃^"mfBP.io$HYgS}o&_ò CP Yul3.sLN0GaOty/QkwL@ LˈozXxeP *P[7 C1MH^+Oh(s}lJ9ܗ X::%.,zȸf1螑\nJFP?g({tB# Zk&K#CّnyIV=V{%?]дtf݃ySx1K\˥kp`7?q:s2Qc:_jM^$$r>=k]<>t1+4 )a奮c!əV6z~+KnC|:2< si Do6Ihq/9hS8WMxNk$if><ה_spv<̡Cu`|f$GM;WJے""#P,bDVv]\F9 98go6֝Ԝ<*;+Вž۲"X $ g7Aqo_Bhh]n_joxUlU'ioTB{9fYJ"AG(ؙğ*T3@#R] <&PJ^"qR >޴9å}/h8 _SsM(|X]X)6!&["0Wafq{?'15'SDxO<%%od|r'|]ZVUx;|#Q67];AK)=ʀ~\_C9Æ0nFQ!Cx{Z"zzt+ز ,]Ϣfe=;13 hkC4zs^z],ι`LeS[Q^eBz+<$أ6I^gyB Μd8ApNôTX̰t~Kǎ^?lWt: wby7ި/ 3lahp@1oάL-6S ' Sç_QwHzȎ/\z?+8x9~DFabڢL/خP G\H8˅ gCS\S~ ڏ! ̉F&{Ojqn^gٻMcfj*O}YB]<->lbXهV!R䥰S$xo=ԧʉ |GO}afE~1|)ގ]^|^pV?_ F6fk#6+xxVJ{F@}o.k[|kMi\%aYLodNn5JT!Vftsr+*JxIY|#*HoZ+Ɛ ׭ЕvLBUP;SɌ[61Et_)/_VITxQ.ڔ ?1%;g.K5lC=zB-}2:~wRSF~ ԧ{y=tO~Q9kcLΎړi(BR2Am\A~F۬i!^ڟu)+tB׻|w7\c<&;TpMAɄ`CFQkann2P7Wj%_'AɝI޴.EHjgC: xٰ7OdjmU[5@jkX1uӓ"_1{5SzXT Ǚ1 TĎGN͐؎Qpt^-u?;HZ3 ypUGq=Uz- sth,]$ AS4⮳"Lo" 2|+R!F:|6Z v{W_T-L!3 XlVI댋7JOkxwj3*մϼ+aAZ%MqJku8dVUz EtKޯPI#61CˋbdcO1~D*@pfmDdo=Q>Iy_c,JSۋc9IϚlM͢ Kg"z#ClЭgV4@cpxFIF[U>k9z;^G!SG *;{ք VpMA&v>rpw~E~4:Z6{pBR`Wl&rƵdo[Lӝ)`fn8$-"=c^Ⰱ~Mqu =5Ccn4E0F?/pg OZx\}My n'է]3G6R>g;eU/z<1yu!u4Sʇd~oV"%ɷZe.|ٲ;K ,"zCZ' -*S-C3+_@wT28$7 A''@F "Z2ϙhu_ 킴5^Qc}hlM?D? YvĖ8ǏE2n;x'57I^f˸F>2\Yl%ĿC$KI]p&啯 6`HLonKX n6`D? u3,ibn ǸOW=̾oz266 =zu׌ uSTyNZg\XHRILj:r8ٷ(?2d-7W,,n(XluFnB6@{&Gc)?&+uOw2,2siЋU֟VC&D[~?-%*m< ,AhBH8IqI$;cyNU쑀,v1YO~$-E hu H#PAA(ԣWh-ۢ fDiLNMH+հwW]TjXI6M[}[ϭ_X7Eؑǭxd2Ӥըѵ=MS+߆voh@ű|bY)8h6Q03@—7.p??/V n0U+eaU:{ǚ=\YJQgaѳn tR9;kqP=Ia-'?>!t09T??784A62mU ,H]nVjĝ0.vD@i`W~钜)Ss|մ=, sh߄pHmV6sN O}LesdTyOݻ& ~ ʀQuZ|WQ:`ڡK 䖅Mu7ļGrԍ,vWRGlcMY@ȟ@IfG0HKF#jEA1ًO:7pKIUR:;kPҨދ O@,;Ew!;!>[8v:##Ŕ},;F}L?K٢JW* E7U\Hyj[w\"SȽ{XPgӁGMy嬳`|A? >RDh)GRgwG47,ZD_kiL(薢f_WR(m(h AHsx'gz#}wheԧ]~}Wj0}e ) Gбa$ -Cz#(g ُ]$Kka-?e=^?1I m@0vѫڰW a* LM>G+ڱ~ICv*z|WF# J@2q9,8DF+8#C(!AbcA_1YUާCom>m|M{~͕/V c%Xjc^$Z!t*44%R5f sGw,=qYQP9glVK'("kl+0w0N]Dt}7uG8&ԣ;"]/S)XK[-Ե8WO $XjI3'r*X7f0v b^Pp |LԽgI8KigMX <@G}C0X)3^/D#r)|Œ4w?r:%լk[/?@ 8$*|#y7T/&<ĝ4< ̯ $i=hecbRAkB(,d,_~+E\*wO0)0fn:yH$-_KKo=)f&2$RdT_yun4dLQJ2LBJTzXXxZi⌵qQ=wI gI+P4ዡLa-hj8yetp BA ނOs<=Ȏi~P37궿YaU-_<6UQ^[,Gof=A>rw3c~> y!?z:F Lv`L7&{p70e;eT ZB=}F!I"dTL/; Z \HȪٙtlî:GU?HZ =Do" rUH| /nluf$2=-.G r| n%ZD Q`+>`k"|!渼=U-`2(ΝW߷{U F 5lqb}E-p(Mc 65vJiCK5&GWԵGg`F%k5]mtW&#,1HCptHPջWkx8? Y@= x*iBdQx~O]hcJ.-`%u!% WwEFM1h4ajJgt,Y)\rw?I{ b\U!gC:=;M ̈́ţ%i  a7ӻtdƶ4)pFĽNKm=o6LQ[ G0 #i5G䛼S`M60XZ5!<5u6VCMQ{I5$Q//ǕrV[N|Ayٙor{AН}1சNßx {_X>p/8mt)&l(1Þ{ nA{ UJbU,4Ԥ[&pÌW7T D`dF"魡7d(/a*JL,t 'dh%7QQ%-=q!Q]qZ={&I0_??B/z#U߇ѤAfcW&I+b265կ M-fXTd9IlZ+y OYFW CÇA!X:_#W}#I)rkB6֛SV9,cxˍ5F!%y4SjUO΁f̗elƗCB&+maw %U$ t^qYBOj:3lk?6AF](Ѹ>uұI딵\7ZsY: BqbmӠR;Pr SGCz" c6. K)\X3iywpQ?xuG±vZ &XO Uj&^&*ZF\G@d?rQ6-Jk?bdFm<΢VEM^L4a]~ߚ%Q"+Y+Y'$3 Bf=0EOϪش a4RqW{c/еȬ[WM+7;)C\cQ.y2~ M+Ѫ,akpGCmdWy͵p`TLKtQ^L;ESʮߊ&_pg0&%}BQ /OQ{q$7&Ym-qr6]`T sn<ꖀN [*ZP1' A1reB7ْJh5yX$`Qv}ؔ;Z,DtB6bO?O9P9krMn9:aإ0w @ NI  Ȣ67CJɲ ;Wih^6$zep?OdlINGlZcK SrZ[JI,([՞:ǪD+Itvt+88Q7a_2bbRjPyhd0}s[kfƤa@N44f^MM~=S&Ӹ*aKDn'ٛ;Qu T״Gǰc2}ܘNnq:=yG0q?dײǒ0* ?( ͨוEQv"}c"7wnֆ. 4!r>`hQ5id:'~ob2^ҴzVHM_U<`MɖYI]fƁgcTJw\W- pӲ# 7M|(ޑ%(OhR]|d$2o{zي)B@H:< Nke^;R<B0iejo'N,oʾzʝ7P)nvs)hb{Bw/ lAl=.^xu_mPs7/Q(j¼U&Js(ZN2HW_ Ҝ)_ro{)H\6 YBn s8*pGi 6j LW1m^OL}"N_r'{";֬,8[\aީo~g*} cO{1FѪXu_Bb( G*3[H ;ovŮG}\-ح,0Xd=A 2^KO!-]P{ J൐A)ver{sa_b4ަwDK5 hRfF 떜pkk1(b[Z?( <Jf:0heY%+ͽb^2 ;R $uG>)qK υau:5G~iorϰvy pL@IrX[>Ű=9i9uv 7ΏA56akLXK]Giv^X]k,E֠x1^s82 o'}=L: M0boZgg֣y/뀽!#}wOez[5RkiSYȔN`h:/QsscMcfx& )9wxѝ[ރ%ypsNaMtL6pO`xZFwK5Q6 IM:_=տwVf^?,N$I*ƕ=#T%De2Dq7܎Rېj==%s/m^ 4SK|!t-&i6<_C]Iu 0ѕ Fh+!ss> $Vg@9ߩZedllf rPcN56x(,XBs5N 88FM"2~ֶ'>i iHSB2hBu'=kil317Tڿ#mjׅ+&WT$ nAg3Ao!l:gʆ80s(7h.HoaP0qb gwmQ',yG&YpEvVAWMm cȦ~NSEu@%rp/Ua s|WƦڮw,٭i,zCE,SCE7ChκvRƭ}Gͱ^D u T\?Y};:uAqOKOׄʞ)1ttל,r]8'生wb͙~tbW p:l]wɬ ]uaqT$gƶ6z?4P2xYBu˯<.We0b2N칋V*(YÒI `ة& }yYF#&jڎRJ2s]o>G D7 ,7ZXOj |1*)$"i|"b1q. O땷 X k/L~l=a7嫅+eKPo?`(IY7($C>%'{qڗP՚ސ?|fiAsB/.#cZ6kFdxwJ]ytgq|z a{ф )|"9]li"oL( N;Q.ӷ:+;ٚV|r1صAz ҳP6VK@r-j~͘ofOSαfL%k"1/)lwI9\cѤVfෘ@|Zr(msbeH[I#I~s9u kR'ŎȌ|~@pL98_tS6XQ^RR\;o¼I"g5Ci`vqɭOemk0>єq@&Ux*9 -5_5S1}tΧ+VhqÇS gV x$$LC@ ;u0K9ur!n^?˜W(SoJ`(D8ӡW$@! ?0Imx^$<%Dt[3B˰:mדRtm ik#'ZtA^,ฑ{5J0^N iS>lbW̆g/  >YiL|ugF 8c;mE`;}iZzx@0[qgu+(=ɶuoIJ>:f@<4,3S##7;o20ȸemm@ᗩ&A/zxy%֡R.U ۄُK܇@KKˆCC'scsZm)!)kJkIwhP %1aCDf+`J7nJIΚ)'6׸e=e1nn,N _RzElB(ܬ5ܼ : Mcr&|ӋklW3LcPM cgtiͽs:w5Jy{N 3kT\_nWNp ?K]+6ddSh1õ|ƾ:3kPv(֬ϋ|(ޤHv BNjz(~o440S>J21뜋 l>lk&ãky{8qV)SQv,׌g^G'UER>+/',( > 1kf /?#kw:UQq<+57ݼ'k G e#qB!U_TW1![qRhQыP*EmrAWh, ̪J^J3 (IwV^dh0: wV5O y&M9 Mʪ[;#*`~.R{ZO? _CefKCm'OIgf7N Wıw 5X=lruiWqpK3i`1O<&Ѭsۃ T& R, 1X&lҔ- %osvbR֜7+ x|ZaZ8t5GnU5̲{^'[>Zs;sm\L6݁&gqjE5y_>mI/)s`7O QBqV 9f>24FU#:Hyo2JP d79q%j_'ڳ27_z׃/b^n;=7PaSx6NyKxo;dJ3|̥Bmw G_1 o1f.S DcKUn<=0U(U2 2́#t1D鯕t0ݑdc 䉵-`e37NĄ:3CH^כ.Ze['pX5 *S͍f]'mrfݤzM|\~[YϧFXVYTLSk@vפfIU -(~Wڑi连ʏcBeoQG:{=&=_5kZfў+[KeV/U ?p@ vM=&qunrQks_DAx#,Ofn1PɫjL~|!xd6f$腝-n o(UFsn7%$BD#ʪp0k2OLΫ8O*Wj)Ol\GiRF\n(aU*:CN̈ SHlt٤-!ʔ{0?=20m'H1ޯ`%_4<6qm2F4^uK xiBXV:%K7jWlc1Ło\-]{&>dJ\Ϡt&8ŐƁNV S:+P;fO{ktl5ĹKFO9|?xіXcUhOwA[;Zia!ˈ g41T½hOdf͍jHR46TK~_"f6AY>[R" 캒p L<[XM=lH}>Ol$@3INɱgKt#>cY#Yx3tRXʛ(Y E^zgp 8̹PfMB[2K p97Z5y2dCZ0'%:\::#?&TaEXePlBk`Ǎ#^5|d=io&.d\!VԹ.IS^O_b*^!/ ?70$|6+%n"/kqN|YҰL$ 2ȉ7=䵚s]G97[ʊǵ(R6Rys0;.$CPE}5LЁYBpѫt)S꽽rJ.O:@5=veΗrK++Q:&ʜ*MkQl+R$]k<n-bsv3'* Ñ2Pb[V/=H{R%\"$DkwSETzy3zāq`h+q h57'W8r.A[̞5b&u?[ͲRAgpt纤lU\c>Ovr{tISj!X0Ju`J 酱6c9n vGaB^6WzS5S@0-q6ELUG^;i JE ;Q}`^8r=kg޳(d|: va^&/ ) ly9K;r*FdMNjlRr2V^bؿY4O4hE6S^J]y \KXO N?򟗚Ds5k'[iKy>xz!L-eR.#`c#&=@e0D_Ϸe6Wwd]hLJnMw@H4_y@rb)A &H*Vwj0-l }p}%o2>ᳵF=jLPĚLhX2=wene)0=^Y .i0غwכԂum52}_.݅qƕC4 G78 ٠-Wm>Ry^`ώ`7B`&GsMD76[Kɼ/oQ",Uv<=g?r_M}G~N1NlLA~o!'&ULgnD@ll9쭟EqI,*<߳AVq8 . 㝢9Vٙi~#ujMjOV]%Τfaz~xrHzeyxrf{h=eb/Js2{{5p_=MTf4'hP(1r_18i0J^ac[::C$f~t_ii.b ;U{69[RQ;u3n"^@oLʇ2;Q;䚈=oL5*ۢ_;+J ٫°y&- :HU/]&.w ЅydC@a w|Y=5oWgȝ)@ uXp&\q;vg07| O2oIdBUܲ|s{R)5dGSkz-111_[3b`*Tclɓޭ0#9ƗK?ɡӟ5kbل0wFLr<<-ȗ)pZO}Ϸlok \iն*l!F72pƋFu0TWTBWq4բ|ܓfC`jH$KPR΍loKl-#kv׾?`24) R;1 9%d^h_|~rP:yoҕw_!\ g.> ɴX6]u*0 a / ja|@ו_#-j1ylq1Mob;>И5.?b4fq޼+S;Rof0OF$̎x㐚z0 cfվx"Ql2o o6 o%9:%kLZ]8 爐#E6$}>y61& &Q ]& t/04x^ɩS2Ik 5Z;'OVYZhy}Ko/@R<c$Me&>EMjRz^YE|)s8ė9K"0gdب0{\ fPn#"͡i_3,}+~<}72ӓQ|-F|7PAK;s*ȿ"WJT kT1-{urrOm AO#Q/;Y]ԌܰЦ1xJg - , +;sJ:sesw ò֊ JN* |`YmG:bXW9,0%Ck|QD,S7~$<9ƅ1wtcęZ~UVxPkF*2ML[![HW?zq5΄+f1`j0knP[清a tYаoњ!D58G~9vSB+rI;!߇(ujgn EњR!V5!v ثSjx1͟3pцy㝨IՃ~#yaVHIUa i Q=Ż=7J=zȜmf<5F0FaZ!c^ `Ag$S'.]+Xvcy`!ݤxv#4?x q[JѨ@}X?l%K2hW'eΗ(޾I܅f [w贃y\v5'q'Ռ*#{X&2YO?7kHn}"pY6T;S4b@FďY*65TbT֌ |wNAձ-{6eRfÌtP/;-3È^y?G 0>d.0w9WAqQ qDFUp#/)Dw?Yl~1'ɀ@3a^gT2,EHtݝo*Mf MW݃>ֽb}a>d$;C7ۭDX~wKqo,'^èkrZ[&9W.np8EB(V {9uT1B]2辙_@PڜT4$%{;436:ĜƖu;eP+tmuM0`=9f0hc@OX~׼9Oq2r E _WLZOcf޺[/LT"F'T8y7`rN+ض"ۯOE͉R{/Ԏ;N؅pؑ~_NaJ<>%Y1ML&)A Q ˨|$&Y)*k"K-ީÙwk,Chԏ0١ ** z!<}Ӣ23N% ![;2gVN0ֺZ/Gj0*)%Tš79땮p\Fy_i8j_Z)b گQQ~[ldUGpĀĩR7%},|cS=ܫ0у+$lt[ .Q%%DKb5%?i۟uE)PE0@[n%TW3ٵmƟp3%\cX$H$^MF3El-Ynm͚F˳ѽ6bml+W듐@7Әu"gy7W0±;(񧞴!{X*3g##Dz!nq,Z(յ}SFRd ` H?li%O~2|2Bʰ k.ԙgu2xu:L[Z#ZYj ze#jEfCс'hJ# &T nRtH&|N8]촾/]rLQ9&u?ôv#q=tZ" *tO(\w,L{  fp8!*]MnF1~YG"huk -9"|X BB^)%E:YdtEL %)M/̾f6 .ê"~71o~V'P2c(\N01FZkܯSAO-+uvyP=KzL ^aW-`Fg(Z0Z4+nW AO1^Qn~kvT{ Cfgǧ|,h0*Y$²G%_t;!J=J?/B4YS+Y8 jVX}:%}o;7T(Q_S2Lip5Βn)vN,W5Sh 7[$BH)K$9biƇgHT, s_.*+ziТ_}Ka( b€ u Nճ~iot:$r @`eӱ3*8&D;_ 7$֦',zTBj}n(ԺB)3Chxa5۔N+N(N֍ΰY?t9(Xq8B>ily.r:͘!c*oޱocȩVE$Ay.e)+:GoVȅFH#E l!XĦw1zMc : LraGB>揇Q|1G*t!7&cQ376G5i(1zpxvLfSf o7pRpS[RAEv:פlax|rj;W2kA esы bVDO*\tG>$+;slh,֓JuՖФ ,ob/J6hϒ! 3c ]dx$p1`c?mJ( ֶ&" bq-oMp)?0M͘Ƀi(8v޵ g)=tw<,8W^^s]K_!ZzAף-,0"]4:(R"/nSĄ?{у$(IGID刘D(O9|c۽Zi'zbW!C%bxX} %^>;kt<ڣnc*o Zws>}3|^p!/ݱWr{і%ӈFN\(MeLZh>Pݺ9PNGgub9KoȾRD&!])(gs0,yZU`8/) 8, *~»2$3s|Ăl0 .j2?tY-kC L}VZ#: BךMV|,)NT塧 TtP{GnK=:iEo <@09'^`{xhTxe6縃7T^l"ib H3u"_uVi,+<ׁ7wKpN :J2&ίk 09[WSW>`ݑ-UӨ_ V$0tfMD@S,x؃zX#k"'S4e/Q[ާF91Dy¬PAb'FǼF\fӋ׿|*+ |wyφ\G)Jd_u^80 ƟkO7աI_!P+ >ӀX55U߮,I ۄJ*rl¯MOgKJqO ;`m5 L5߫QxR0<=D2 [ݏ#'4]ErfݾSU;P O7_lUB m)4eo0F3ϫ}+ZJIBt\jLKGʳbo<7Ι ?|(tl3J"k1kf8j`ՙ S*Ȋi: t׬TmL'1ޗy̳h3W0;WN8. dw\E"[y级:G{: ~ZO 4dS} 3hL'A4{V#|`!WwR#B٠ ڼ^~r# C?xѼ,g+tG e¹䍣AܼbG *ɓؤqtl6 !q$pSn{X7~J)c:P _4c@[z`2kcj+4Vmj==uT39(0Iy˙?j9 1B_X=+SF2pp VpjDQw4qvR:3 nI .Q3V,MGY!U^2ݘ`R`ߨa6hF7ԔqMVY,`| MR,|!Hݔ(aC^Y| ߁NԲ -ۦnfpΠxZ `<҅z}rj 5g)d('jSe'9 LY>cc塘롷M?|^\A{,bv !6R0\LNݑ_#_;MnnchX:+p(~LeQeP"N,;)gZ{|ҢjXcΡ@nYrLzU8jSO;8D)|˹xm_u?&8+OnjN4v8$V@`[^O u?yezU'~4=EW,EI ~H#!8luc@9&a?Of2w&۬Rx4W`%IT 1q=#Y 2[~(aRn矲qr)^ iNDdPEؕ3T?{>XF`3AH2&qv75s(,$SM#RI4-k|BZı%'r>HmЯB^13|o݋߀t~ZRx}FⲄ3P?LL & =Fr<" WQkz%K;U^6^AMq4,cTYu Ed(wvs&fnNn%5N@9_vhz_`޾ ÂgP&^s^I.)zaZ]GF^UV4$%B#58S$;7pUZʕKPYUÅVjaH z"e%;b0Uڡ*JH{եsՂM 4prDCLcejPGJĬ~ peuEȚNr^b loI_|nr'SuJe! THM5{4z 4"iܷa g NHWC֋/B}ouQ`4iekP..p-zz5!Pl-o%} t!]*/*ˠ;3t>].lߴ0ktGr~vM)J_Yh=S3gv# .Ź'~3`J`Kdp/:14l h&ݹ/W/xMn B{LmV*N=, )xP]{:amIV@^[ĥ/?֌I!b^y.wq@V>Ρ6i -BEoEC5`7H?TH_n  cCC?7uĢkӘgM!nK=D-B}p̔5Mo"ԫ6թ Oly'8;fȵਿ {sQ3EQ'#D$P?ǑNJSrlGF(4Fn'8Ba;q\d-wvA3Z|cv3˾H5bb,鮐|,AnNB hOaN8DI+"3W:_\B&+ -^e>rvQI -8C=&39퐡xiȷ\eC#`ݒ|o8aJm!=#@ޘC^_`0ҘW(7D̿jFc$k6Yt TQ /QK )mO ns!pMeiPŜ K]H*7n Gz*됱wn4vi)pJ%:HP4/Y1crQkxiZݍq5HK']NŮZDԅKIi3d 8KR+Cq"4Q ϯʾM^ G7c%0Urهf, j4h>WkQ49F &f}k*9=SA@1b]̔]4@@ WnIZDa|RN ~$%K{o ׏iC)➆)gANLbu:"nUTń[Q1`~vgaÉR[0+ӏqȥI-N4.6VzlHڵh)w|_U||Ij_il37 N`sYNoG.d+e-SA?(~Uy)fJs8}J]ue]5olPizWbfv/lsωnmy3">" |}ZE nR J$Cas-7s&K=Sa/]W53XQ*x9{f'5ÂEr+vЩ|vZx}x׺2Lt煗KSڂ58&2Zz8᫿ҋBIJҠvxRdUOBp>[bY]qNZ.Q&I >ē։()Z;lWrrǾQ63N>-ŖA? 5 /(ZyrCFo 7Z+چ!,,RfXX;ܙ@άE֓)TWFf CC ."/bI< {'}QUY4ϧA}#;R \/~*SxE5hρ+H{m%PHfHhx5cEF馰K?V.dTbS KSǠjדEX Va7AeGu*W /v씗ï΍3]Xa4V_{{5 ZceqQ}Eʽۉ蛰 $mƾ)wMmԋ%pb {ΒV~ۼ]I$x:<Bq :sW=}.C

m,E\oCEwpG4fsr@r<B[w^NҀ\O?C;Ft -b^Zo1bУE^tݮeXYKe4,]5vuB:mwտYP Cn_B{F&:!`Q*&l5 i~3{!Se n\ʄdkO7nU*."jܻ3kltEd|ȽhB,k~D3,v|)),6)V;9JeT˪-3 (M/Lxj!VLT wp6P~@ϳ (4%V$ V(A PS3 3_$tpW瘻se{Mo iLNv$Z* QW(iOYؚ5 V7Ҍ&ȶfjq$/k89L$uYSjXO_zbmq,̖?H,*0$YшL=6hm_Rֻh-1R꼧`1">툷'n6H= Gu@'=',x\PNj)hш˹\?H{~IR%_Tf4IԴ$㓱oҮ|,qTp+pCdZdKmUi}/5 w;pس^G+[:XgE^\`:(Hsz6/&iN>,bTiyܺI3$\>tb QNzNF,4%v,c&'ævfs߇)iKf\p4_aXy`DƉ PD?$H6Lb0/ZHL(,/ kҴva| !MqjsL}T}eSiSF赟VT8ջkNԢY(zFEOhĩ=S tCFC^֧%bS2C[QO_gC'V]hwY3\֋ӟ{I/TyX:ҦBQ$GFd]Waf Ҁ@xQ*ü'b3HQN݊V8~_QrGx[9&N;ӽR!zk$*Qdnߢ+_P&$qcƬ -S:^ݖjkNvOx" Q1*TXV-g^lT Fˏj4=6a`OѨTQ:&lxQa&z*M)(</A+ʫB !cU̠Ja %e߇"׃Aif?V7"}yE>kE{]2V;gҪ}ԁ:egƋw !FaWqql| EM}/Z,};TP*E-ƛeGpȨDĺ5E:@@;+Nj"ϲK=\#̱@* ߊXod.6S}H$6*\$ M=7Y}["xd3 `ѳɂt{xIuOs:㷎Q?/7p脚3)WأY . ^IgyuIOlڌZ")++_ `S8Z26L7ʻgM<6\HdB&p\r=~%ZT =NfwiFeTO[o/^7Y cɻڅ%)m1ܐ~|-ѬqyP#.1p J{iv<] F}0@ ۧ[@@zcIm.1C^u: lVYm]*>vۥ?a$U%GiIBJ0m s5W^QB0)۾ j$JƐoozZ~V`u>SfDFg]Yhh{@^E1]fIXdvy) YHlHukӃݢ o 莔cۥ_#7>e- x>ֈ-"R] (c/zK2/4gXڱn4 \:|Rqzj5Yq]F|2 :۵%| nsC:4r`|/נmvI{4?d0I)V߼<37_Z#`:$܎ڜ\KҦP1WOY=uqĵLTݗ Xj&Nm<0/)ѯ~%r3hJډGF".-Hpez j! N@?3Fz!xpQ2arA,X:}צ!Xxi!mLHhU'x1\槜_W`B?Ήqeտ972#JyBVERt;27 (5YHCe"H7sHUm $q̧/O`%![Y٠ʒdyF1[p66QUsDuZ ȚR )iBܨ}0%.XB#B(4MFqO|1eQ*r.+{n8пܗw1#LXۑJPaY">/{];z84UZ Q%68;9zST|;4(=u$7%$ e.@[~{7Ql)7S\\Ay/btgFf0uLL} Mp2(Oq8K %,{@:tv0~hgؚN靟[ҧxo]򌆔ah4\ǝHE؋5@ #\Sx=poykKWH qS!>ko*}j$L5wWuxolkmdKp) jX ysP@T㥆$ffԾDCQm'EFMiӵ{m.LhVWM{"!N338g c}q=ֿ_/j=VmAT?Bgزa xAM례dzi[c3`*&.#p ;{Hŵ_GF3$@20A N6܅3:},6kˡ5Y5VJR4X{K7<\K_w$zZQkGVZ7*h3 eb!2Ico,>4ఐU9Se.PKwmf8&x kD &;JՂ4IN aI=gO"ԉhE5%[=rx/HiVB5|(@ 9];dKUE j,JPfq!﬿욄,$uQ\ -8ZrRܲ;bk+WHNwϥU /BeeytX3|6d]wXXaӑ^+cgN1einelR K"YaSͷ?#Iڟ$ぇA[7 noS%7" C6Ye %tܘ=V#5b[ NJN\8GYfPXg5ƪX-#i öW kC3"_\`\돡s}}u+`TO6 sgshB>/[^= QeSX+慛-\̓uJ;e} u#{RCRZ?е">栠܆;R0c wng[.>!BCdـ8pNJn)KgŴik7 mB^E1^nz)N_SY8;:Oe~}#W8Ԙ`Cmol{$9*s~`qK0_`ӵ>Q* 0oɵJN:ca$-wil3dʮKoe}8pWzD].=pݡ+P=XեMtA;0=}蒮y[|?{=V#ܠ,q>:gn ƅNod~C`M?KToR7ahE65v"V붴\!j,};|6(fR$l7qq0[Y o=oqlz,!os'_hS2lT W^EfYjN 2HvPh6S2) ytLuH+VbT#}2%oDx4.2Þqa>X.2Vr[/)mz:fYoAkŻ=`3򍪯t43o#GFR ^SD*D)q)7Xe17}b{1\:T AvH =:/ XHA/ϣED2^˔&B2|¹⢲}q!X⑳C LG1r!_eiV= mFѣ/ቆKB_%,ͬs̠y>dBoX$K&[3$*fibZUJ '5J*{pUzT-,XC'CHy+F Iw-F|"CId:"mBE_brZ[.?nFae CwLJ9-O}Lt\EF:٨:4>5y E"9hH4ʥg@'u_:s_cƈJ% zl`d+yrHM6ΧS]#:M&ۺ1ry5gnwem}T1X~,<L8hE+_/m?RT6|k SދYuC؅RrL+yɘM~אX)P$ZYm^L-IW+[e?To0s%Ik$.88 }$*; ?KGȀb~] -łt77RC$N4Gh먽o1'Ӵ3uoQSHcR+kpd<ػ@&Z̻4jݲa Jx }V\vR"*z^OMA )8%5*LZuɗ.L[h ?) b}Y:GtAab?c\>>{5%(8?SHB;=-\ZiGv(K Ɋ6آj?l]I;irp4f(U[+ D9rNtoGw&~%Kl2P 眞@+2ހq~w!| $׃+ clƢ,*)u 79eDF g'ϩ%ZFWcI gF2-o$s;B'֕⤐ hd/DREUMv^r>1a/^3]н:fIp_ vZ {"=пRR@zB3@c"[H)Iwh4査VcP9E$E$&tl-` pdxoԍ *=X߱sm BC^Q~烝7 _]\/ ,BU8-bLŌ$RqA-Lr@5._ `jwUdǮF|a-8*uf"3 IhHW]jRNΌVyTW} IH8|$Oxe1aWDnB{;;9ſ'UN$v?Ls'Jk#iyIKM. h쎉T2F{Tԏ U\;tE028V3U|Zfn6k;\GJM"f^ww ĨDzI^S0W#o튈u3)Hp]&n-7KknT!(04Uk#-;,M{ܚ^MYKuC9X'sE-%qVu"-Nj758ab+Xq_$J%MLu3ʗ- [ӻB:JPc)å )w1 H: x|=fE%<6lsu=-o :zuˆ09R-[HXGT?K^#<R. .< gʡ_P1;M@2[E bi< 0p!Ѭ9R&NSսzTT\Z"KFY#`)42s YmFx,~[HUs?%+YUs8!ͯ(MAwsZ,P8xRkU`Bm%C̏?8,m/nTm;FhS!V/:WCţzQcoaHuF̅콕PhܛUsm7t4œ̱GIAO'OBоI4tJmXϧщ5qh ꙷi oc%B8.-92.z x;iӘͣ( !OC0/[kM\ݒa鷴B|~wP FbP0~_q֊mxu~G9Zr[[ ̘x>*ݠJDǡ q?2bZ|aCM  I.[ Cbw}J8yr,ќ:j$>n}xi +ʱF)/H|㹝uDD^\MS,x%/yZ} _8ă̋w:Y :FJ/Ll"0 B! qى<9IOhR1f _Ϋn%JLENYix@+qܿ05@{:v_ù/UIrvTE L;[3, ^1Duɉo*7XuQq4zqM@T̿I!0/8\#Wdi NZގ/{eik)չNc~yY~qqojm!]o a$"; A~ҢQLjfAbsuV#2%Dz%rМO uD!sB9)>ucakj30i_R< !^IZ{̈́YO҉Cx(VJ!E);8ӼE~'pF%.qrPdj '$x^ +.=S~pI)?)H5oLƢl >]Zl7õvb,ir{PXUèyމRLm.~Z689Y:Nx(`NRiPdʜ3q"G Y"eq!oBM4ە2(ۧõv)M3wc| x){ T'T"}DYI6dD1܍HXĴT; DYE7)Ñ졄*Cqs!Z~uN8$DLOZ~}y^sX-ڣl=H`$W2ؚˏlL+ S)my' :r$TXWhAKzx)ps [*3z %Aj0{KkBVGy%;i$ a;%{ wau5+\"q; sƲ`a= ˘Ѽc(لV.Ր jY!UՋ/ΒJEMfGޟ!׌1՘vqUVH9ㄗ 8N-;*EwZ2 )F.rNDuI_3☓5Z1^ehEI6o -pdm AxϾ<<|G:@=ͣjB&wͫ+fGU%&4LcV0f +p|[.{q*>ތGe<^0iŝqAwGra ^sPGU7H〥wnRp=]4cgU3:Yⱁ_;EES5]9mX.oay!Rڋ:f-{W:,llwl/Y5PƧ!lb^9]&Kf1i=^qvcAt !˺v-(yFvvZ;RZ8< 5s{!esFI:o윛-s_,[y ] EpS%KCW&yM׽IߕO{l"">79'Nry@TMOQrBY۽Kd@4ȼdj.=fXjwl2T+E=K^g[SbZVd֖38Bd2h_rO8<~sMa >(g&GQIeXȁ~H0yF'& Q22͉WW\łLpD c]~<}pG^]K7fc1 JF,8 f!`.8yCOy.TgDY*>$^#rtrT;ۺwƞ:XPl"7v~jVG|sr-}qh|,L9 a`7z;m{zWGŶBdTɁ *n7mV1& u2+OfyE.;*&^`Uj`p^(i(/3GkrpsglǨάQ{qNh3G?2! ]2,( P2C2_sQ 9뱲^> *ͺ$GHw^o9vQSngI:t2Z (^rK =4-ѺD00YN}Q}ǥD_XNܓ)RB{b$oGzPrI^B ވr@A :!ӺnVq%udҏaI5=^ ]HF,!*/K84]I#H5mZU4lt@*Y2й㾦<Tf :NbQu-]&8UF!Vq ƈUA|r$zygxt/xr81:(lQDbUy2 ga UyH:MF4$;|ɿRQ u u_t^}9䐄J7[L \ 1٤Djyr$,i7&, F CMh-yZi+4[f $l]/VWD 4R`]`pPs@!%İ.F }n[B ])Ak;=M{x: 6.,, (NA|)W+A< |By%cH<*[5#+;' ɿoLg4@ #Pnڒ,z.sB+mYk]i9O~}+"k|5PcTɲ &na G 7hZx{wjA!؉҇sCūOw_NXp2'd#C xn"?ywS~f"5iȟ2$oyQr8gZ ?j˅ [Nwr_lzG}6tǷJ-k]`~ &% -A]68$K= J~6.6|F E߬cv(E4!t!3+xEs)Ob[]Ojd7GjDSeءo˦vu?uM; dI # F2MevZ=Ts{qaف@Y dT3Jv[ ѕZf@j+^]0й*e0?fU"ڻJr2`NL\U/eA~6&Xx&zG#k~[&F$z<nM ekj|J2w\&%ɹ$D#jM|>!ߥ2cFr-h-DSPpmފSfw'bkazOXV6~Y!5vt,*?F [t-gwEu"ڪoeK~e_H392rM-c)\ݟAy2xO-;>B:]Lg7Cz/]; bOtReXy%s*[yBmRzMd`!h6wV{yCy҉Om-|Xp8ê,dKٕW<\i0P䭲@˵2Rg5RAfՃOv~q0au\^uD=ECKv*yr=_:fnF9Qw q6nN=tJ6Ysi3jgRF=oI-\):P+raĶxbM7Τgm1otrI A^UY%&0QX."ln@ŀ|k^C^h+ 9Kqjze :$qAN_` RSnRd#F0VjnVRH$MfwykaH:bvpCzFf@mEYlB W!S3CYRH$5y YaZ-+)Zџv}^!V'py!ppibltttdJ۴P_TnP+WX&fl^U;=Nr&L+}@({G_{Il6(A3$.x-eH,!+9 Y7xF8 'iS,uHɶ,mZ( (fz nV, \v" cf\5"sxFO \}oxv>3cwրTCJ^9оdjl>D*E6릳,UK[.(1aoƴEZ'F|B蔞ON_!&7.uOИ82]_G/P*~H #*ڢzᕗŽϚUHAay6xx:.ZSV=tOiig[C:7 tAȝ3.Ѱ=*<}m DAs{V.B *ƪ mt#'5zetHRlPJ)U.-gT^|QuR#r}xaN".;}ͷ+0ef3M[w}X e؞ZU _0284 ac M}B g ů`mMtHrrw #AV7!\sVu}b=./~]cODO _ j _ |+LJzIF(m3 y?uD<7>; zn蜣7QODe3t塍 U`ܺݾ.ZЮ@5X[mo&!Ǽƶ#x]ފ-*?ъVJ: ֬F8]ABn\;!5&} }HFW\2=O^a9A'{~isG{V($.w| †.Ck6qeHH:,5 o4 9{j?ENH>QHRTtifMSvՔ^b*Z~ڲHYA]S=(\G`L Eɧ+! xnt/Hmv'3:0YZgCy,թ+O+W"=Oc+fmk(#*.3B'x˂.R)b˽ur jV硺#%^kD}`+ bRSCa>V8TJ$ٹzh>Ǐ}g>q~ {~! cI+n+=_&a+`*51K×RpaϽfؖ·7lGah&uȸKOfmuCC5h 'MJZ91tLJCMEDW=yˡ P q^Lo2>2z3˦7̨D k!hFɂSR[[2'r 40:fSC7h_=kNQG]Gv|)Yjo7p >^E9'ŦK>Pzfx w_?K+dusf7 qKnb"*WSւ*z^Ig+kzs,ʀ\!h MN6#ӚgVo~=! m;aq4)?=kES79#~W>8-HuBe~U2B8̳b"3aQ}4D+>w 7*b^yU. 5ϵLZ}N^tݘ&كSZW%)d=FZh 4=t݀Q&62۠N#k~_}("1{iݵRS~90+]~@.y]Y-"(N ҋY`!DJ=?mFE27@[bO)7ǝj\׌8ˋ')Ls˼vX2>3cE%u APS\Jxwi`eh>>ìC$aX󍯭ϽBN4bDʠRܠwv~X!Lj={kPNq̣ʸVw#=7]b&dVoWZC<%0"\6!P$18s$'*9T<׹%>4:&JH{*N0s\KsXQ٫}JQ?1?( rY}n,\ffL^]ڕ1ȸXTUCEq+nkuхq0rWZd-n!Y(a4B!"m2\sT\>(ܶ._K~w F [XEuIgۻf=K<߿5Ɲh'њfy.].E骜߱$Fֺ1=WgMcX~ÿGMMՊZ;ai z Fce Z9nya$tX.Z%@tE{ư?Vo'OHb:{5U#56-|2FSc|`-[-Ňc{4_='hh[\4)=2Y၇v)A|~?LPVnSf-p *xUdp aSYodTǢ ħd~:,WL-SsޫT!pI5G엇$5F<3N7Y S.hʝАe<"[@zdo{AO 4L85Z yl~#cVML-6[zGBgF|$o1#sL$DZA fh>&?)QQV}_@T 8rLvdASrnr͜ oŽ?W+_v,]#<ѝ$\^^*򽋿xX[GE%- |_wO*ko$Q8%PW-*J7{%$-{I kkɂ'H8a7p5|`ma'Ӝ׸EȖ7LZ5 Yf%;9K͍nKޝb o$86~dAI]M 4͉F;YeaETwkqƲ:Oez_C]MpAi1AΖj7sSbO 8N6g{ljsawmQ~I0]uͱDZA|P-1:wt?^?|sPtNWE󸏉,]_~H û߁tH'Yq4 RIBz:=!UsL(!/C[hiXЙm̷*[p[mS㸯L?-pO }3H X]aeJ Q=Hӓ0Ǫ}0=|.5j#.{Y%fV9I^EG$d\ #($z;_A8*)jAz9f#mfAa3Jx Ig373RR)p;20R܍y4ˡ*K>y #[Hc2)TpE@i@Qr գ{| (_'*}`!I|[ /!^buv ׶\Ql9(Go' ׁK#MV$dioa&B鮆!?eMQdR2=:bGmY?XdatXPh{6keؑEt${K+6l `h_ Ǩ>d `Dx! Nc`B+_a!-gd&u-Sc^`6J™z ygkj5ο[Ҕ7XJ$hz] zz*wW(dhG!JX@4d˗wpHZ1&̳b ;pѤnjY1]qs4 Tfb{]N0/{G.;=5'uE`nanP[$+.7*elpMk3QZMn"Ш|?bJ=5xM "C% IP"0vNZ#@-]NGsiHbzi? {Ãnl|-=/mn?>QHҚy{T::XT.1c3+„D!D⿵"YzuOL;vTz`Lu"l;#+cayj[*ۄ~!UP,_AU4tֽ+Wp=1&+aV rI-sֽN/n=T jU 9_Kxo=%ˍ"~xp P]ɷ8(2|w;Di9\=%RX$%#L^i\t1E>ADfp68X0T%)۩i'* qgXYU^'f'U!%2&U|"fgi5:RQEB= 1i\/1cPûeoSTh-]}0JG7N!z';+w0臁Zr?;KG)悚t0_WU.TR6 d8ѭ֜21R&]",@ u^.(xf;!L PeG7Vw6`$:*ێ` 8ReW%XV6A{ʂRKrQWwsQD/.`~ntK WDD]AE\|U/?Ig} ~_i`cTV[u8*@x顥vxیx(.j4tK )M ʒ.EVy:bPo5&G1\$ JyZFQa#Iۀox(֒H/ x'7]&@-'9YiD扃pCm,pm2) fpzE`6ƛ":剋\ݰ<3cحכE0ZR8j:*TQ1Tq$~#X"Xs6ߓwL`Dc:+̲;A 操 /#(y۱y"svptC{ed 3 }qd73QVнqO ג0Em/LSDΌZG2䐘21H6C(ﻮ޷b!kUvփVw4nq}.n*zplf = ˨$I%a ipX;b@' |́m`mB|g]Jh Z%]} 䭯e !h 7U"N5AUk0dF `t}uB4 .L"~f'@a<]ΚAZSLbw`k94 . ވI  s`ï,.<^'-GNaRf)WBZ>TH0~@݉7625)])m YrӿJNcbz%-ߞBN8-/j"_e-sg0GglhxYHlT^G/Kd"Ppn*NH)9d0G·h67A0󫣧:>?RɵG,E^4r6O8' L i[y3{TCX+ ;Q 1d|g@ys8<NS.8tJ)\#Vł:> >_*hђR/Xޗݭn!3 쓽7Tfxd쬜]ʻH~Er AIY>0-%Xra52̩/Lh5ѦHg"I9c'3VR=t:%f94b4<~X c`U1q,?rR5HQhYdmcMD{kC# `Xg5gLifgFV9g34IZ(\A28p\dpF+t%"2 x.yCb&T&TJX<'[0UOp++s"-DJ]ԇkPpȖt_ (8 W@Нz^\r?ԅ!Xo뒐|PI#,mAxs4?H?Vq:av&Z"2F'Kh]R⠼{Klw ˋvygWpZBcf(]UJH;2/DZs0?P-_*7~Z+ٿW`k_${U˞U+qeWJ(̠3Pk h%$@[PI]"[4ɭ (hȸJf'Zb߬co1x3C#jWHn&~՜7tjU5oQd)r1$U"c [\`[{WT$oWG$;X > q p Isɬrڒ*|5Nj`hz0ZO^_81I4 ao)̥ DqB{F[..[efq`KQޅ#7/_wkȊKs|*i[hh!I)e5u<|V.):t75mR߹{H%[-ZN2.lD#3ժ '8(Ul:iCLc1 04֝9LG7>m=Xݢ9ݪPCu4H*y+= 85m`A0kUC*{%hL(?Nmf`Ǽu˫> '8P˃6.HyXZ{osLAn8=vqAyH3cRdamOvH] /!Ur)އ]/7h:-|?նSxUV;e6Hv;;zO*kƑ n ɯ%T(ߺ1b7IhW )R0a)$OŦLg*ߪ|T?5p4ny$%L[: 0&8tVt"igἓ!%lyߕAe{v2WCS(meo5Jtb -ulf-b16 n㠵z"T;2G _4p9Au\|SêLqTb[  ڝ>G#=vYEbzc&eb < GRZci^ZHGa69#Z"[b0 pga̤P8ͪv8Ė+зJKPćӃouz6{?#[ D-pw()ROSjPTwB^)H0/ۿg'*0d/P߃rz;Ac;jB8 Zc{˚9ڰqqTBj6sВ,On,FnzTKẼAރFi7iT2s @X _- %r U9<哚t&3S$O@#;+01"qIi Awq㫮yl27D(@\ >++$AP{bЦPH4!SRJ'T*۲LaS ?Ïd5&K S'd7;ySQ q)9OAfB:yWf D+~l Ck|); \V}<)zŇ?smBĕ\1/P eHtpn„G^0){<ˍ:KDG #]~8S̠s XD,ͩ@U_c}O+\  VZ~4b!]u /_$:g!u@YYLo6ɬ?KQ qs(Ory~}~Ui'e-\6+-~J9#LJ=~w tOx,gQO^ͧ\EB֮ qUBŗl]mY(QRX/6vIAaSzCF0alRQc-B{9jrlhGXyHzc6@KAXL"p *QrjGэ|%T3-}$+IVT,?5П 9aЀWݲ-LU8%j$lE/JL"OQxvgk.a쵣)֮R=|chgF9X9^`YA=<.H3z lo0U|KekN pzjR5T:2z5.,tqR %gIZ:gDq9Xh11É/.ogVnS' mz]3jHmsOOLG|P'/]̸C!D[X Ѹ7 nMsdՠf ) qhW=㴝>&7p>Iv z8e]IdX",y8^.~{r w~DA]rF%^RQ1.(\vuL`o' [_hOzlcHjnwC,o)B`G5׈JD#OEm }a䧯Cle8E!pem],45c-&mZT ˉq>[OIs抬KVLdLT:Ӌ ,6Ky|Q:peK"S$S i VvpN,)YB'5NFԈ IRE&J[êM~v8ߓѓ"C5ؗlHhHf8s  5" p9T+Si|o" r*JU4))f*8=x7uǾ H9V䆡Yۄ<˚i4sҋ+ucǛ0X/בOrKh`,6\˼F[vޥlj퓐r]T\87FlMO;dkf 9dɝ+uHFG:o[̆fM5{^Ǻk÷DN !F!~:M[DpH  Uv'Z QDc|H8?O|fA F\hYr NA??O6H+o}H]mq% }@QĐ@sn(wGAʙΛL؊iZ/h*Oi:B_v#ᇩ4#鏪f錃0c7cٙgId;gT#$MCS) b)o_m58DojUPN|6lqͧ k82_ "eeNiz7&|G\=1wePxK<-x&CNpyG9]r#RU@G98 .u]hsb-<7tHV!煸.*/|Z@H]= +B@Ei$b&QgO?jf^d+ undXތ[ ##M\2T@n7\V B'lbһ8~@R-S=W (lGЈD-Zrmw-6v6&6,%Y2־ۉ~gJ[&dbT/R.40R:w gB$BW!%Mҿb|)ѳ /R|}n/^,_;Of""&N]Jnj5ɏ>s[DgK7IUOwu65<6+}:B/C[I}Z}{izԝ:F5ҕGO@ڌV@v`rTDs7u@XfT%)4J 9rC?  /[p^,gh"#"xWH,?{MAaI|-]SsO~iBμ2d u9G}p@BC'_xaQT@x0L/iˆ>N7r^Y6dSXgJh+B_bzKjIast*L#h9:a68Pԭl08+" VܑˣB+lØA@ok.Ojr]ݰ, tP]cICL~N9_{r]n$qԡS\qYT#+'N i.(/ÎtqM՘ c~_;ϩ_:P3$`$xV703oV)9vZ,^fGw j|XT@&Pjվ B-7&)x8ƖQ.E㯦~R쩽^ƒ ..cYC/ہ/ RMAj c(WbN ܽ:3f؉ƲEXBĢE_A<1^19kJZZY>з(.pA4Fu?[ui0wNg/IHÃ>m<4Ԯm*N{˰x-whUG Kv1"AB2PJF/.d ]bD;h6G֧ր"[}@d/[I,oXa ڃl0ZMbڪ_]8'`}MA"U EC=>V!ɯ#B'GytDRFlUD%`]Amx:ζ̹;7w\A?Tc209ج|1`um4|hB샔cd􏯓5d~kQ6Ъ[f1:75%]P>`5﷪dgi7mfB&h Dd]$Dw epLmEzu;98Mǩ;n<vV,b>Σn_U|ӯ{gs#ɦB8ɳF3MfAzQVk @k1-خ4,]+1;n*t6Ɠf˜i!/b6V|5,m~~Xyu`=gQ GU_ێ*6ҫ) .h+ ,yyP9wdd^ o4o-~HzyEu:'2E=;Fw֢¨!wUd\ Оv A/FTjĪgRBmLkwj 3}_ЙV 84=7P 1ɦ~7h}5,Cf& in{r*_RW@تYX [!ע=KH?`d]^2f|0\Q " W l'0^)o)*-TGLHx/1C+ɴOY9*¬4Vv/\ќ͡ѥtF ^R`(="* jB棉9ەLQ) %DCT!䢷 "? !IG\[g\%i0*DGUe .-ZN?݀Hc p7BZ=4uK&:ewsb^-.u;Ct;A$aq/~ 1aݺLb(\I{; R|4И{z5eӾJWcEx>1NiKʾTp,;T_l> ;;aD݅3xANnDY7h]V@H~NaŴdɴ»ٶ.O|%"r(HW&f> =-$ƼiLZ٫Gੀ !1W׫/jӜ\cR(ZFcIpŎ`QO*hM<:Gz7^>_H%VOB^0o`E`88AKp)o̹e>*t7Wg)<ͷGC@ꌌ]\Bh^\IxjΝ2*{ciԛo[G ϧG {ʹ%zK궒6dd Ak,7'#2lK D'E,X[F?Gln1mߋ8Iw/MN,'f6'-;t|eHXK58}'ŠH[A /@h)~)t")5'Ÿӂ >↙ރ>Eڂw A"*i,a3CbAV_wشҌ2IRۓ;&uxA׋HҜT:U{a|3;t);9<~BA! 5a!!뢶cHsx|.O|?L+9rleK[qo\Im䜶oR΁ckԋTw +ZcENOvQtj`xJ~S,ɖn;%]n:b4=8S7H&cNEnL**3D=i)'rG V[ Dxȇ m#t.th#]h:-gt$Z5,U}gc^٧?jՅ7$aKn%>VM!G 𔥜c2x&w#W@X?x2!o=QO,h;Kb,9L&?`\[1ԗWl9F@e]|4` S_l!Z_o+}Jyo &ha9&N0QJ?fP(ڃaGԚ>|c@?!:-hL@A&e ^v?tVqM1^M3b>jҀ.XkTuwNZ]+h6Cz;Z *ga#hXqtaFe"aE lS+n2xBVS*6Wl $tD Hpcbz)[-ໃ*efBN5WWh/U [Hk:Pշ zaVʈPeB%p$WO 5{ωbVݿ8UF„cT;?J]C.7:X#;q2؄zYُ kC; |*{DAګ*-𐄽1>oHWaCƟ5 ʮrHϚ>$RX z .(VBerZ LQyULElHl<_ibh~7&bDR3S**JlưVFs?;P2VlEIN4QЙt9OpHƎ ij\|RX񓁦>9K3gw2{5Gg:\,Ԡ|ч3U kpn:88>$WPIvO_WWE ?Fԑx/kGo.`f#H]ה SbSXt _ZI{rűm5NZm\$PW[ܻkݓ3lA6, A]ژQQ`/23 RmXYH aEoT)TQY ͊v(y{%Hxg|riO-Bc㱊X+ܸ: cB/hLu*&^tGS&y︷.w}CL$ d<ԀT." r,o_c2sf`uF lZqxzY#D~E'B6-&{GWIJw7ω$z{ ֞ RPV3B/YKemPrYYn8f܋A%m⅁w=g_`q}1f֘/2jMÄ[! ,])Pq]_.ٓP+G~k/BG45U:>h>xmǰ 2( ھWгbݣ3gQ *jv2-kqy;gS7BeakI%Ɂ~0'{{ivW q'b1au:R븋S9 pN{Y]noHocP?7gաD_ҏ%:&ҶaQj͙6]Z5Gܬ>dTh?r{yu<)}x WRGxQk6٧9Q{^,.pEz`Qs}-Px!1{CUܸ%As+96`sмuiaw{+)űwbkUK̳Q"9Huy m`j2 C$$>JEWc-B8EXz߀ ǘ 8,ӿ"fL'ޚp[&Yt!T+C,Ϻ:|*lĿU 8 ۟0,E_2+Ve9@NBńpdv<΃R#X "+9#,$i.ك cK;]T X%n:i|4\ .ˉlo`*D]&3W!w0׉@›kԂҩ`G7,m9$َQ]Jejo/X~5CmpZ# V2AW%|ϞvN35+ $ 3GtyA#ܒ<-VtJ?4k*qr)SZ=ئo{.&v۷j}8j/Y(q_Zei 970d%ڳj]TPثK9 7+ 32rk)PFqrٿlsU!p,ed@Z/IsihGjkg,$Y(c:6ݜ,)Du$45H^qżȂ|E'5e+=+uyaֺa|-4G!@)k=OgҪ%N ]\ >ѥӀ"uZ"47pT, Dz'87)nS$Z.m}|7rބ&?n`a+$;򹼵 aPeP/l2$+PS2q:2G Tkj3φ8wr Wq2AU'J3J&!"[ɦS핝ߣMgfc\*RF?6Z*}ŧS+u\4ŝg Ц|RZ^fP y*QJ)j}RokbΛj\mj"gwDw?@Z7`1Q}9R9*79/(cU8=uYIgBaȭJ>sp\8X6Сt#;czoGJ =݋M85Zyk/D5(&^&QA"FP;ƖB<]~G 6%UN'v3F;/}o0Mع;HȎub*It1 'ܜ!WʲYǕ`icrw4W 3ƇJ=; PhNދCO* e@f]8@UQoq5Y.K##*=kIӊz{&up7ٟ/G@7^P?3  HVqs,同wQRztX.WSGjo!ᵯ6 QuR>fHkW~68Wl{JB0\~6U^@lObEd&k 'u?z֥n0qxM=< T{Q]Cpf@f]Qnv^$)̈ bWt=`alBr9#Э?svU0HfdFt.rQ٭߁E &ɫӥa @XhR yP7c+/9W3?V*vgsxֵ/#h>0'Ρ巜8{FF(u_\W?Jԩ) OAE1x4`̹kYaXqjA~d,!?25 )Y'(z86[b7f?/_2:yԀye|oOB_ʒ(4M?QE1Z2yi!{$ϛYKrZ gQKH6 5{ =N;친ꢵHrj`x#zБe =Ո%Q0޲Կeu[JjzVxNNPlD2*P up Fa{nSvIP>sbssRΒz+v0=w=|a:dSӺ9ʹ 4n(^ uZӚ_$X`&3o޽L.rhIV Qٔ)L\ڏ=.^& d@ SH+<_Z'}t + +ܔ5z4T4X q,}U3)#U/zrYeǃ3H]en ob{O->J{NتJڈywTx.mڣ=bP T!m,{Mc {#i$$o)380え†ׅr3@YUG˦I<(sr?ϋvƈx22qCW Ô{ J, QvD{r8S7<Ѫ0Jd5KBC<.aw=K,zq5 e3kzgo]w SH%tg oCtR&pCX#[4ީR|2j1=9L}hg%04Eo0xXIW*AKǨF q5TB+T:ykWERO~sN8 Q+_x457iIIJQfgκ 7p~ , 2S=fCvrݪdY5½|oež M"E0_PGK6WzqʙBn0&BD** _>*sOY$طJ?3n'A}*Vg$ao]% w=FɳTA"dw%k0 ؍SIOa8 [QFB4g2CUosVW:eFhdgY!B?b`=$G!!Lh!^ʈC k 7?:} YD:/x?^2Aë2KCRZAV]ךfWفԹj"֩*Mj 7T 稜1&Dgbiv+u`™f{_E,NĢpL+6]C,A 6(ԓhBT=-Ӿx4%N 10IW-ض$d'F]kYyLj=IҎ5 ]MZTAkŋZ;,RZe9R{0lQ:F0zbAǿ~BWSFla458wޯ9$Bz*R,˂" :^| z 5ƣgt;oBq5P>䭧Ļ2|D! hE,D} k {4E,ّ̀ʡ3$լ?2<=W%$1Sp0xJ>)T*lm27-}ihm Y֛ZogrQ rf{U/*T#V+QZ.65hI6*۫jW~Iba|uPnmkc8 A9Rn@<͟e߬(*`T\o xь2@c)IT`^A.tخ:4DYA>-UWl-ĴRY!_#BX(#gV1eP$~r4E>H-`>%ｪ` bU*[UɮO)qbRK޸;AFB~9LIkɉxW%Dak}<[ܨc~\A (Z)Y+mf͚ݞPB{#f:9q fPffl['VmuJp E;Rw?i4,8JO׻7 m2ٳʨ ϟ)  Xb heX[8y,)g%u} ao7)IV8lQbDVc[?3FVoOiȚsΣ;qD+ɀ`Z! 9"%p?HY >ʁŊuSI]ӁP@098SөH tFيgdHo|G<p(rH\>}hv$@εX#H:~kQʨJXaUIRE20gj2z$TK:͖4)+|{CSY&$zlvEQq?_`،CZz f*EqF0 fD91+,+@)8u ֘nKE* c6i;7<&ֈ%)naKt%!Nþ 7] u,~c?F+MCmèƔvHϿh`bz @ovg*ٸNB=@}]TyE4CbIC KaWpç,uՁ=$uL@umP 0 7@|ߪ ۓ)gzEV]@ J:l_Puyn?CCVo )v`6J]y>h7/7 YF gCZֺ8`xtq)ur.#ƜvF/df|tw\aLA uULU`2iR qMVKl[Ac1Ba275PcEԋ7]a㿬[e[/{\Ei܇W(M]4kJ@\0H*Ac 1bvgU/Y+iǪ/CoIC&h# ܸy6ݪ[o'|d,sSpSkq&@T>T3ṜMav'3ht|e_c5/dFpU[@{avu yF.zKU jG>/\,H"_Bѿ(Ṙ8(\k$0j'ӿ^`H ۡ 9%PZݺ:-c1mU!kF4/]wSQ(UdJxSe1B4lΆvQ71QUե*`~N4.2ݐS ė+P0~bPRC\ km= zE^R銋}qa Pْ4 w*"t V$ij(8}ie-׵ZQToz1˨"i%aJ_{̫?Nx,.gu"̾K  va.A&v`@1 e@&Ib%~CMGD nFc۠V"$1GFf,\9/X& f_SqpߏiQ\]B^M3Isz\ܟ8{ H&R৤da>v+ sbV׻H;//;)!cM5#dm qP͎+SG].a܈dxmˆ@v5#nFYkѶ"qhk8,'t p4OQD='\}*u"% ,BۜvTz~GvVָϛT]^BbRMt>@K㢘Ct䚤5^$w~6H{[fATCϔ94 U@g.0 lK0͵S#^ͽpK=^"z @T 4L0gOO"a!#"sp#C%^% ۉY *h%0o|8 z 2obϊW/O]A?j3\|n% so&hzl,9l=pmv:OB'R,GHjAqNC%.}KlH <|]6&M-P߃` fj3Vͼ" JU,{ R^&ģz~r!7/@TF }$vlIvF=+@D0godCZC5ii殂<:KAƳ~t*Ț/zK$+ֆW^j߮th x{LDxm+Ls c!ۭr4屿@f "Z.$DDz^:ٓ"G7uW3d+DOP+5~Pm5މ^l@RKFx-OcͶ:)8NC[G}Z9/ t~`|,iI;iWY2X}X:VIQht{'̙x'p+ 7V@B L4̈B bBLybF9~aw*̞ūܖč0T ץ崱0]k6kr2صJ'y5ڥ!_ԒxZ5eKq|z_SiIb ~$x93BQe0.x2uQ]7csQX4`"p i"3DS_j͗XFLT9w?]rL _˩Z@@@2Ťo$ɣ6<=LHzsGA^xc§MbvR =~5,n,+Mus]1?sYvOSwB$?rt, f:lD,յ v\wFkefܚܖb*.Hgɲ×tJS1]4Ӵ36I2PjE9QЪ˫yG4 F1cm!NqJ**őıg6v[Ohk.ȺXxpGLq mͺM`ћ*lei#IOlՋ 0.dqb"n:N: (d7)w|Ôȟg5?>|% hg_ɼRLGFwnKwU0[zhsRNbR~qqYd[UbKST"_ Cs[nqzyQ`;xi`KEff^3t~ n_iOz߿+*"W¢ #6I>Qvkma0ґڸ!SjƘ# uF:Yэdgj[?({ sT]7jZŵ@$BXzfN" P 8P}:dz$Q/&- _hAV$e1^(=@vm&mc&ҋeAe +Y{DH \Z&aE4 8VOw1$?_P6ZKZDE^V# B_-"(pQ㭬-esGRZReQ|"(ѿ_ G@a0U O? mv,)sDR%$<fBg iSz#( mw-ḰY*o.0DSt Y;b­c/'qŀ=.oϕbPn}/]•v_rASÖ|:aI>sAr%?Kuwh}wW:91в ugluELjKTNb81ߘCȌ ~y,]c7fqR´߆N#HІv}MZ 0W ǃ޾H,驸W J"[} '>ܮp eޖ5r/ C@lY&Y㶱5z_ϲhMH,Ztg9 <ؖhƓyuF xPa)Tޏ³ /Kxe0vkL^β{bTE#k͍3DorY[h .pmfGɪp4c]X3T叼Ƹk K t"@HtD%#V\S~m!H{Q3y\q+^/<ޞ+(>9ߞcVђROjKI>(q|B'8˅:pQ{d1 [q_G9862pYnV۞  q mg~O)xe:*]`]Uj`ɖi\0O5WK 'FkWݭQ^f惻NMގ?c~^U$xnMVӾu'~6UX AWʹdM%IeKsRO ÈjTNR%}vD s)/7jNKJTtI nWȁ7?h,YCo/Zj%N|16&M}^M2{]{h<Ô㗴f4{a['#e>_hѓE1AtA!"LĦs3ȿc̸aɉFYr$vj Mvʧm@]E켒mfOZ9lnt`A+"ehcӳ|br>bh1/?5Z;TeJw@H?ZKׇͳ>/>= q+AAv\<)>؋sֲf}iC-m_SZ6Ӭ'/TZ58yO'_do;qM%WnDG6B1K 4ܒJ#0FL&wu1OvGEzk181ozjZ?=]{^Y_hBsp%zq%34)qZ#`o*81[@$~%g7.?ۃkԼŔ! /erZS䓸lB䶹Y 7]*$_cWS}-a!/i޴C˽J۬F@+-nU>Mtlq냌HZK~,Ԛo9cѦnr xvA[+w=|$\ B4@w9׏ML+̮ˎj.њ51< =ÿD.p )B,̨fCezW`IʟD;ld;E|%qgo{Ա.&j[Hؖ]~1g./3c(D8͓Y]aEh{ƫߦ!JC頺(:WG@ciߤe%hx"O,OJ+>`+a%<;5%F_Ṣؑ䁒x6S2!v ӟjyY/ -騻UA(o9 O!÷??:bb! 5`̕m9KuC C|m,xa0, ;V'栄8'J #Bqg:qT6H_c}RBL?=rWO,^$oAK ӉTtuIoQUp*C)ՖFFA.RqkTͶkbo'6#}7ǝO9st $?]FѦ38݄& &m DsVBNF6U$]޴qatjM~/չ*\drv=a m1ustWaVZsm,lh -`jd}ujhf3Wi蝉 Jqd$v*_PȸKZGz%W](K9BC]z8riqszV 3dIvDz mhF3/`wW`gTj8q-Eơ5Ҟֱ53q5XY9OoSOk-~ְH] =FAo<2INW%ilK"D(Traפ {Qà1Gm'}ý%XᏔrnG&ъx/-[8ocWPsG&#!J6?H2?~#pV%YETI ֳ;ύ&͙YM<{0Y7s?Ez"JNLf'ؠʗu!w3XUʅ#Y1By䢘FXOt9e7J iL~^6b&uN L _!>'l{үTwWv˧6E*D.rV2at*6s!JBn7/w:kup pYBXBo Q̎GklI U6{&gqC+xcgwz>2澠5ʉ/ExtVqq5<}^C5@263u(4-Lܓi~4%6+5CT*V=U.w^2Al˷ѷYGqR8a [C5IvrމtLE蠵^OWC>iOh"Պ[o!MJUWBnkB,X}c$TA> a1G*mJ:60pz*m ۊGyW9mw_oy~`C1wh+_@Ol1{%MU'"U$OPw;1(X$ϛBuMrVq3ISwwJ k'|a1`ed8-fcƨOΌ_ļ*%YVfc7VXȫI>MF~.4ip }v$sWt6}J`F_H} $.mw. қz.`2u,+ X<#`dcțOQ Mi6g"et\Ę):ɸ'P).Z33TE8{~.iX3eؖX]#>˸ 6̽VaVJP@9[c8p?V˷mbK1J$F 1%&xQB~A/ydlm('SpFCQ5+,REj,66/Kb&,v祿&*&%@}oGܗĚ^5z n8o"Y]6ZIP|8|)mm|>!!#6}a:db*0ylj|t>[:ψyXc_#="?C̣>,XACP#S dY8Ϲ6sXXҹ9{98vkjh31z[aCud6KvdaK5^S+%~ ڗں?J[ț趼Nȣ3IQk#vG2E׺ LK`!(e{@UW*KA'矕ShnbBL^5T$Ƨl{ȋ!(=9pĪ8I#8m݄IhcMy[|^XrXA Ozj-R'Ahʲ+æ2'88⌄Fڒ?ykA[ܸxBG}OP @naBs5O6gP/9\T,1 w[[(R^0eUƷWYs&>`W'ˑ+ID=ݫ1xoj-$8ꒉm[4MF7[#ϴ :lt8/=ӗܦKUl\M J x 4R%O%bBlW6t{ߵN#yS1&m=ktX\=X6 tg}|4ZtčwTȗ%O+$(TLD}cB'~!ܾC(̀%,Z>'Fo3f4ڟbnc{ &rvJPEe\$"+^%;wD=kJI%LSd^< Q ѥ3h헢LcgfE-?B< x A<0{y'`#!- I{WFѝ5W4W :xs?6H҄.ʔ2 ua,hDW Sn ̼'~UE2rٟfJl hDXe >2`=LvȻ"v~BKrH7_pcr0}0~~uzl Q^RmEExAP1&,R"V5cz 7y6,ʾί z0|MV+7zܳYy<:s9wfQ* v=tQ ͵'mƍ`q ʒ.pŷ vj\hA{@2lѪތ~`k&aj~iJ(KN+lT ]Qpjm\wZ:a2觥Atw|~!T!zeAS st^c_NӒX#ٲ] U gxBuC ZJIfzn=gj2jp)!QM;+\:(W~̃d Wcͬ*;E+妙Z. Bl?E[Z`s[CGs}悮Y!hô z6==s_Vg\3R9ꚍKź_4.0oc_(}߅jKYbJucؾDH6I_W[+GRgj ӂ??DŽ?#h"uo몹PIgws#6(l{*D)9Zեt=hJUQKftǣwlʉsN:(\j^Ғ({؀iĥ zSyLaGM绽,Z3v4 P09ߊr)V:یAa>%ЕBcEdcd6zUnL#Ɨ&9r꼈,b'ZwnKГLSFƣ;* F:˽ ]jBܪ֗ThLl4{VPsYԱIp:x%^5áA vSE]ie,0HHJi?#ExԬ'&S8K@IVا>"ںqT}?ʟEA]n d(0Y.\*oQ͜gx&ƼH6 *ûYDKD3"4c!ތ+vCv$Jїb@z/9&OWR fcJ)А+jꃌ$OzYnGVhMfY=op@T_)wtcc}h[03|1Ԋv~ۀwsOAzz~93Щ }4{EP <)\/N.Bl9E FPsLNC\L@95QxIt[',2JLG̻$91H >"kv|(NgdVN,PC3(V e3 ׼UxF4-д[n8oPUWlo:RHryg Sƣ^=&ĭ,ڬь*w&}e=Ġ]֏Osiɵ6S5cn˞{ ӌwM \=Q/^bl6<=%yW,\d7AFS;ĪsUvf%(-&X6Ldс;‘; {Sp;\u>C^ &EG^L@^AKNd3SDG"͂B_d@)% &16}Tǐ$~TϖT_=g"y`0_0]榒2~_E_tD%HL e,抋 v@ر3O[ѥ<7ۗ6/޵fd@ tAJoqEe M$CxÙ < @i,À1(J8]1z8 .ޞs[rqKw_]S.YC%U^<6ҋ·G\MRw!)[_r]^\91,}E4 '\-) @[eLwXS'"}̧]emM)g18cTطH/g7r$7Dep09gіݑ}'r" ߺP xɊP ǂ?\ZV;yU%[ȈIAQ ]Bx`>S>5쟊bN]{\qGٔBꧼ !hIq'kef%2i>7h_l@ȡzR6(: 4\_#r"C JQA5aKek~Gy'B )lwB ﯐M`3KV-/UR3P ^(*&2#M=i]Q$L|$y&f -vny }cxuAxDaI/]ACX ʄhN9ЁlXNlbu2H|4_7]2Ƌ@ u!If#.N LR-j!#Oz ,aP-ȸ,U#+/xGhl&vmZ ΃7 7VK}ehMbӒ8X^+,[@ػV/ۭ ~E1# juEeٻ# \+J1I﨩v I|.UtoA՜17>tTbSh_B0P ҸXCSK2l8<ٟ_o._z7!R%BUB&pIO]SzvǮI늨 zUOzax])}T[XN4A]G2Rdظw.;{i A>g/`9лE߁XY0+/!JT#Xay^1$&J[C'Wd\9?'Xc|=<7lȤLlX[͇ϝo;bY4KT/p Q?&OΖ ԩMղ @gː cu商!:%{Q@M{/WWNUF&BX3dYwi!@-8BZG$upٜ0 B\"Iߏ m4zD[5p,`>ArNxRW=TcZ_5;A$Q4`>I_ߡ[<raOI*8 H`(>3Ҡ 66[=\Wkֆwy.;_C-A]晀=}X;\I֡^+@ڀ,TvQ]P$IȡԂ,RR/WQcn_Hfdje酟v?KJw[ewcza^&Y^- S藟P9}3~ D:ݣ> \qjyI|xu_33haY eo&Xo'{_>VUId Jfw+0d;*< Z&\3"g&*PeRXW<Sdxn)wfƊXf']_6j!Wo{Z6ŦÖ@6ui 5 ;&z_6^ӫ3F/)T/SY[`ȸ%bnC'j珩tfΥHOL4Kd>ˎ2JF-H `} b5LHŲDUय=A2*N.GIھc0j :VZkpEvl׬ (v"eSwUAG ഊul躑9wPi]V1K iDŽ!J5 .zD_jw:9>qY 6W,KY%ھqGTYc(^R[&)"UN;6~ =)PJLM|WI:p?9;s01!_*q>sN.Cn^?PK9,ty!9 .0Ԍ_ ^ݕz u>de3wGdnkxbm??V%{ps&s4l}R.1rcT9V41cHsPe9C-JLFC0GL棿Dl5p= [{8;k@JwߖF"`T ].HkƄn~隙(TXb39%Wu [ @ S'2z@o(??QHBi`)z!Zp/ț$+הg{}6'G@Qf%&V(:KTlŝz>}xA fyCmK&>,+{yKqRQ#̹?L+c@3y^0~V {VlѮ!_ MTssxێⓦlUɑn܇_ȸGwfj `KXˢa #hA=m<\Y^x9F'z3I UK: Q׍zc4_m(S[C #b _Θ,h( >B1 CG3#C#L Bı1z(`uޭw_znDoHi|");vlOj,2&*x]MAxlb"1[zL4S7="raFi f5[% kPʯu5Ta,C >GWHR(QMpkqyz%:>\DRz9zI.bgT48S-mA@o cGH.s2RM Z ,t1]ѮYY|" /чU-ƭKKiAcU9;aӔ7?@RJbAÔv@ٛKM4GG3/ie_&GaͼOQw'xT"eK0F.VN4)l6 4Lo[qx~˒*Q15sGoA,Ox]fk)B@uNU2,x"#Չ{ t(_4u ϬV^ Lh^7c9#_p|2N7#g Y>a%#t'Tqs~5 m0 H[TSq>*bzbóM xWՕM܍>F\Ohu0 .I,V#܍ qqAIA%^u7ˁ( 癄#?+JFŦs1.IUձf_̤4YP,h5p\ƌ"t#*4&6_8J?Rgj,KH!l*wN. ٕEgS#JNUKއWu-C}Henzrǒ\8tVYfދo]7Qt_ϱ/W|&/^&b8LG"AY '6Q XQU7/$"Gդ-tFW\ ?wb7W\o='eǕWg#3DR\G`T$XNN߻+m.k+NG85\3fg& 8v[ݛ&2V"!qe:f -N5'[gq,;x#w/l;W90RfCBfcYr [I%#c8l6l +X!~gUUolM 4y:괗5)LwAمu_ im(z!r/a6ofue/HYNr5MYj'TSB}}K@ Oq+r"Vߥ1`+Z{^vUBk3(䛭})+^q^